SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287D058 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287D058
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.79e-43
Family Nip7p homolog, N-terminal domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 8.84e-27
Family PUA domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A287D058
Sequence length 180
Comment (tr|A0A287D058|A0A287D058_ICTTR) 60S ribosome subunit biogenesis protein NIP7 homolog {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=NIP7 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISG
DKLVSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences A0A287D058 G1QF14 L5KUB3 L9JJ84 S9X993
ENSVPAP00000003708 ENSMLUP00000019926 ENSTTRP00000009493 XP_004273256.1.21590 XP_004319746.1.83887 XP_005318425.1.77405 XP_006091215.1.53796 XP_006156984.1.99106 XP_006180639.1.101512 XP_006203805.1.17985 XP_006909872.1.64745 XP_007129088.1.24612 XP_007449990.1.90284 XP_010960849.1.22495 XP_010977518.1.51371 XP_012597893.1.48125 ENSMICP00000008791 ENSVPAP00000003708 ENSSTOP00000011532 ENSMICP00000008791 ENSMLUP00000022297 ENSTTRP00000009493 ENSSTOP00000011532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]