SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A288DHY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A288DHY7
Domain Number 1 Region: 24-218
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.59e-41
Family PP-loop ATPase 0.00073
Further Details:      
 
Weak hits

Sequence:  A0A288DHY7
Domain Number - Region: 348-377
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00549
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A288DHY7
Sequence length 390
Comment (tr|A0A288DHY7|A0A288DHY7_9BACT) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=1394709 OS=candidate division SR1 bacterium RAAC1_SR1_1. GN=P148_SR1C00001G1079 OC=Bacteria; candidate division SR1.
Sequence
MRNITKQKFDTKIFFSFHNFFSQHIFKNDIVAVAVSGGPDSMFLSCLLYDFFVSQKYNTK
NLIFIHLNHGVRTESIEEAKNIKQRFTGTSLEIITRPKTLKATENDLRKRRYQKFLDTMI
KHGANKIFLGHHFDDRVETSLLNLLRGCGVDGFIGIKPIEHHHLLHGKLVVRPLLSLRKT
EILDTCKQQNIPYVQDISNQDISVSQRNYLRNEIIPKLFLQKGFEKLFQKRYQKYDSQSI
ENLLQPITISLYRKAKSAYYLIKNRKECSAQDLLRIFKQLHASAGITTKTLQEFLPFVQT
ANKGRKSIQGVIVMIAHGKVYFFVASERFREKTIDNKTQITTLHYRGKTRNKYCITEKIP
IFRRNFIPVVIKGNKIISWDKKGWENTTIF
Download sequence
Identical sequences A0A288DHY7
gi|563701086|ref|YP_008871198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]