SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A290T2A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A290T2A3
Domain Number 1 Region: 98-398
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.82e-60
Family Carboxypeptidase T 0.022
Further Details:      
 
Domain Number 2 Region: 534-608
Classification Level Classification E-value
Superfamily PKD domain 0.000000235
Family PKD domain 0.0051
Further Details:      
 
Domain Number 3 Region: 624-688
Classification Level Classification E-value
Superfamily PKD domain 0.00000157
Family PKD domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A290T2A3
Sequence length 733
Comment (tr|A0A290T2A3|A0A290T2A3_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ATC97681.1} KW=Complete proteome OX=1117319 OS=Pseudoalteromonas spongiae UST010723-006. GN=PSPO_a0468 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MLRKLLISAAMLGAANAHAQPSQHYLVTFPNEDIEAKAKISLHHNLIGDRPNGVLFTLSS
EEQSLLKRFGATLQPADNLAKQFLTKQKNIFDKLTNTSTGIPGFSCYATVEETFQQVDDL
VAAHPEYTELVDIGDSWQKQNKGEGYDLKVLKIGKKDLVNPPILFIQSAMHARELATAAL
TLDFAKQLLAERETNADINWILETQQIHILFQTNPDGRKIAETGVSQRKNVNENHCLEAN
VGVDLNRNFSFGWGSVDGGSSGDACSATYRGDSPGSEPEVAAVENYVRSIFPDQRGPNIS
DAAPENTQGLYLDIHSYSQLILWPWGGSYDAAPNAKGLESLGRKLAYFNDYRPMQSVGLY
PTDGTSDNLAYGELGIAHITFELGTAFFQSCGYYGALVKPDNLKALLYAAKVTKAPYQLT
QGPDIADINFALNAQQQIVLKANATDTRFKNNSSWPMQNITKVRFAVNQLVSDDNQQLAT
FSDGNADSITEQFEIVINDNQLIDKKAIVYMQAQDSDGYWGTITAQSIDTNPPSVAGNVV
CSGAKCQFNVENPVSGFNYKWQLSSGDVLEGEEATHILPSLGDYSATLVVTNSIGVSNSL
AIHFNVTELFAPEVVASHRCNYLACEFDASLSTDADSNTLSYTWKAEDASASGKVFSHNF
SQSGSYKVELVVTDEHEQAARYEFDLKVEAEPEPVPLPEVPDDVKKESSGSNSLFMLFIL
TAGALIRRQRVKH
Download sequence
Identical sequences A0A290T2A3
WP_010561090.1.94128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]