SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A291K9I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A291K9I8
Domain Number 1 Region: 146-264
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000759
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  A0A291K9I8
Domain Number - Region: 63-115
Classification Level Classification E-value
Superfamily FlgN-like 0.068
Family FlgN-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A291K9I8
Sequence length 270
Comment (tr|A0A291K9I8|A0A291K9I8_PSEME) Cell division coordinator CpoB {ECO:0000256|HAMAP-Rule:MF_02066} KW=Complete proteome OX=300 OS=Pseudomonas mendocina. GN=CO724_19280 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MRDCRRILTLLTLALPLAAMAEVPVLESSSMQQGSSYPPAGYGTAGAYAGAGAQAPASAQ
GMLFNQLEQMQQEIAQLRGMLEEQQNEIQRLKQEGLERYQDLDQRISSGAAAGGAPAQNS
ANGAINANGTPTPPAAQQQASAEPGDPAKEKLYYDAAFDLIKAKDFDKASQAFTAFLNRY
PNSQYAGNAQYWLGEVNLAKGDLQAAGQAFAKVSQAYPSHAKVPDSLFKLADVERRLGNN
DKARGILQQVIAQYPGSSAAQLAQRDLQRL
Download sequence
Identical sequences A0A291K9I8 A4XRS8
399739.Pmen_1279 gi|146306311|ref|YP_001186776.1| WP_003241689.1.24137 WP_003241689.1.32543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]