SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2A3M4P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A3M4P5
Domain Number 1 Region: 27-209
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.45e-73
Family Clp protease, ClpP subunit 0.0000000869
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A3M4P5
Sequence length 213
Comment (tr|A0A2A3M4P5|A0A2A3M4P5_9PSED) Endopeptidase Clp {ECO:0000256|HAMAP-Rule:MF_00444} KW=Complete proteome OX=70775 OS=Pseudomonas plecoglossicida. GN=CMV24_15555 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSRNSYIQQSSDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLV
VAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLL
AAGAKGKRHCLPNSRVMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLET
IKRDTERDNFMSASRAAEYGLIDSVYDKRQLAS
Download sequence
Identical sequences A0A0A7Q4K8 A0A0C1I4I6 A0A0E9ZIY2 A0A0M2UCU3 A0A136QMQ1 A0A168WZQ4 A0A1L5PN27 A0A1W2EZ29 A0A212SHY0 A0A285YQ22 A0A2A3M4P5 A0A2G8MW46 A0A2K4LSQ5 A5W635 B1Q4S1 F8FXG2 I3UPM2 J8RUT5 L0FIB9 Q88KJ0 S2JWL3 U5VBN9 V7DDE6 V9UX19 V9WXN0
160488.PP_2300 351746.Pput_3469 gi|339486803|ref|YP_004701331.1| gi|557222355|ref|YP_008762570.1| gi|431801808|ref|YP_007228711.1| gi|568181253|ref|YP_008953792.1| 2005346800 gi|26989024|ref|NP_744449.1| gi|148548677|ref|YP_001268779.1| 2035921207 gi|395444305|ref|YP_006384558.1| gi|568186684|ref|YP_008959221.1| NP_744449.1.35174 WP_003259400.1.100978 WP_003259400.1.1079 WP_003259400.1.1090 WP_003259400.1.15314 WP_003259400.1.1643 WP_003259400.1.17434 WP_003259400.1.19681 WP_003259400.1.23948 WP_003259400.1.25626 WP_003259400.1.28295 WP_003259400.1.28354 WP_003259400.1.28475 WP_003259400.1.3142 WP_003259400.1.31851 WP_003259400.1.32670 WP_003259400.1.32932 WP_003259400.1.33515 WP_003259400.1.34900 WP_003259400.1.35335 WP_003259400.1.35996 WP_003259400.1.36216 WP_003259400.1.36363 WP_003259400.1.38432 WP_003259400.1.41 WP_003259400.1.41505 WP_003259400.1.42045 WP_003259400.1.42506 WP_003259400.1.43930 WP_003259400.1.47320 WP_003259400.1.48025 WP_003259400.1.51289 WP_003259400.1.51843 WP_003259400.1.52680 WP_003259400.1.52768 WP_003259400.1.54338 WP_003259400.1.54759 WP_003259400.1.56258 WP_003259400.1.57632 WP_003259400.1.58218 WP_003259400.1.59340 WP_003259400.1.59535 WP_003259400.1.61619 WP_003259400.1.61620 WP_003259400.1.62279 WP_003259400.1.62773 WP_003259400.1.62816 WP_003259400.1.63899 WP_003259400.1.65173 WP_003259400.1.65739 WP_003259400.1.66713 WP_003259400.1.675 WP_003259400.1.67665 WP_003259400.1.71439 WP_003259400.1.71479 WP_003259400.1.71624 WP_003259400.1.71677 WP_003259400.1.72310 WP_003259400.1.7288 WP_003259400.1.73136 WP_003259400.1.73516 WP_003259400.1.7435 WP_003259400.1.74642 WP_003259400.1.75010 WP_003259400.1.75189 WP_003259400.1.76210 WP_003259400.1.76710 WP_003259400.1.78427 WP_003259400.1.80759 WP_003259400.1.837 WP_003259400.1.8488 WP_003259400.1.87606 WP_003259400.1.91273 WP_003259400.1.92076 WP_003259400.1.93113 WP_003259400.1.9402 WP_003259400.1.95600 WP_003259400.1.95946 WP_003259400.1.96951 WP_003259400.1.98117 WP_003259400.1.98215 WP_003259400.1.99927 WP_003259400.1.9999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]