SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A6AJ82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A6AJ82
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily Hsp33 domain 3.92e-81
Family Hsp33 domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 232-288
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 7.59e-21
Family HSP33 redox switch-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A6AJ82
Sequence length 295
Comment (tr|A0A2A6AJ82|A0A2A6AJ82_9BACI) Heat shock protein 33 homolog {ECO:0000256|HAMAP-Rule:MF_00117} KW=Complete proteome OX=2037913 OS=Geobacillus sp. AYN2. GN=CN643_01980 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MSDYLVKALAYDGQVRAYAARTTDTVSEAQRRHQTWPTASAALGRAITAGVMMGAMLKGD
DKLTIKIDGGGPIGTILVDSNAKGEVRGYVTNPHVHFDLNEHGKLDVAKAVGKNGMLTVV
KDLGLRDFFTGQVPIISGELGEDFTYYFASSEQVPSSVGVGVLVNPDNTILAAGGFIIQL
MPGTEEKTIEQIEQRLQTIPPVSKMVESGLTPEEILEELLGKGNVKVLETLPVSFVCRCS
RERIADAIISLGPQEIQDIMEKEGYAEASCHFCNETYHFTKEELEQLKQLAEAKN
Download sequence
Identical sequences A0A150N6P9 A0A226QLR3 A0A2A6AJ82 C5D392
471223.GWCH70_0066 gi|239825650|ref|YP_002948274.1| WP_012748843.1.25537 WP_012748843.1.33554 WP_012748843.1.48526 WP_012748843.1.59651 WP_012748843.1.67826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]