SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C1LNY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C1LNY8
Domain Number 1 Region: 438-545
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.75e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2C1LNY8
Sequence length 587
Comment (tr|A0A2C1LNY8|A0A2C1LNY8_BACCE) Sodium-independent anion transporter {ECO:0000313|EMBL:PGT99464.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=COD19_19285 OC=Bacillus cereus group.
Sequence
MRGLFTERFEGYSLGHFQKDLLSGMIVGVVAIPLAMSFAIASGVKPEYGIYTTCIAGILI
SLFGGSKYQIGGPTGAFVPILLGIVITYGYESLLLAGLLAGIILCLMGIFKLGSLIKFIP
RPVTIGFTSGIAVIIFTGQIASFLGLTGIKKHEEFIANLQEIFTHIGTTNFYSVITALIC
FFVILITPKISPKVPGSLVGVVISTIIATVFFSGHVPTIGTAYGTIPNTLPQFDIPEITL
ERIKQLIGPAFVIAMLGGIESLLSAVVADGMTNSKHNSNKELIGQGIANIVTPLFGGIPA
TGAIARTATNIKSGATSSMSGIIHGVFVLFTLLLLAPYASHIPLASMAPILMVVAWNMSE
QKHFIHILKMKTGDSLVLLVTFLLTVFTSLTTAVEIGLILAVILFTKRMSNMLVISKVLP
DHTRKHEKLLPHVVNKAHDCPQISIYTIEGPLFFGAAQTFEQNILATIHYKPKVLILRMG
KVPFIDTTGESYFRNIVQHFKNQGGVLLISGIQSELKATLDKNRLYAEIGEENFFDHTGE
AINYALGHLNTKKCIGCKHFAFHECIELSQQSQEANTIKNKVNALDL
Download sequence
Identical sequences A0A243AT12 A0A2B8UUM1 A0A2C1LNY8 F0PZP4
gi|384177899|ref|YP_005563662.1| gi|384183542|ref|YP_005569303.1| WP_001214612.1.100241 WP_001214612.1.13269 WP_001214612.1.80964 WP_001214612.1.83070 gi|384177899|ref|YP_005563662.1|NC_017199 gi|384183542|ref|YP_005569303.1|NC_017201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]