SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C4RKK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C4RKK1
Domain Number 1 Region: 771-1036
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.96e-21
Family ABC transporter ATPase domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 6-185,244-302,329-368
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000862
Family ABC transporter ATPase domain-like 0.058
Further Details:      
 
Domain Number 3 Region: 471-577
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000157
Family Rad50 coiled-coil Zn hook 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2C4RKK1
Sequence length 1043
Comment (tr|A0A2C4RKK1|A0A2C4RKK1_9BACI) ATP-dependent dsDNA exonuclease {ECO:0000313|EMBL:PHD77353.1} KW=Complete proteome OX=2033504 OS=Bacillus sp. AFS043905. GN=COF64_06060 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRPDILTMQAFGPYAGRETIDFNSLGERTMFVISGKTGAGKTTIFDGISFAIYGKASGED
RSGQDLRSQFAEDDLLTEVSLQFILRGKTYLVTRSPQQERKKKAGEGTTTVGAKAELYEV
LPEGKKLLGANVREVEEKIKVLIGLDANQFRQILMIPQNEFRKLLTSDSKDKEQILQKLF
HTELYKRIEEKLKEEASILRKQSEKSAQRRIELMKGIHPGNHEELQAQLQGEEPNEQQVL
PLLQEVIVQATEKNEYINNQIQEKQKARDQVNQELSKAVDLLNRFSEKEKLRKEKEALEA
KLPEMEQVKVQMKMAHKAASLEKQEQYYLRIGKQVQDANAELQKLSEQSEKLRTERIEKQ
DCYDKEMLKENERERAVRAVHQLEQVKEAVMTFASLKAQVTLDEKEWQTCKRLREKTVSE
HLSVEAEAEKVAQEKTEAEKAAVLYRDQEIEAERNHSALSKIKKLQEVLYEIQNTKRVLD
EKNNRFQELQRIQIQEKEKLETLNRNWRSGQAGMLASMLHTGENCPVCGSQSHPKPAQMH
EHMPTDLELKEQENKLKTAEQQKSQAESEYYQAKSKYDALLESSQEKLSDLQNDMPEFRN
EDINEHLLQFVQKGKVLQEQLKELMRKKSVLNDLEKRLLDLKEKASELKENLISLERKED
QEKTRYIENSTKLTGLTDSLPDGIRTEEEYNAAYLMAVNTQKRLQSALEDAQKNLQLVKE
RESAISAKKESLSGNIEALNTELKEEREKLIADMTNQGFSNYKEYTAAKISEAALGNLED
QVQQYNQNWQSVLSLFHDLEMKLKDVTKPDLEGLKKTFDFIDEELESLRQKQNELQAEKR
TNEEIQRKLAQIREEQKSLDERYSIVGHLSEISKGQNSFKITFERYVLAAFLDDILKEAN
SRLLKMTSGRYQLLRKLDPTRRNIQSGLELSVYDQYTGQERHVKTLSGGESFKASLALAL
GLADVVQQNAGGISLETMFIDEGFGTLDPESLDHAIEALMDIQSTGRLVGIISHVPELKE
RIDAQLQVISTQKGSRTSFYFAG
Download sequence
Identical sequences A0A2C4RKK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]