SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9EEA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9EEA1
Domain Number 1 Region: 193-365
Classification Level Classification E-value
Superfamily vWA-like 3.53e-40
Family Integrin A (or I) domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2C9EEA1
Sequence length 577
Comment (tr|A0A2C9EEA1|A0A2C9EEA1_PSEPH) Uncharacterized protein {ECO:0000313|EMBL:AGL81976.1} KW=Complete proteome OX=1124983 OS=Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0). GN=PFLCHA0_c01740 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSLPVHFLRPAAQGFAAGLLLAVAGCGVSSKPESAAGSSTQGALPQYEVQHADATMAKRA
VHPMRLSAPMPAPISSRDSLVAGYRDEPREQYQKLPDNPIHSVAEAPVSTFSADVDTGAY
ANVRRLLNQGSLPPEGAVRLEELVNYFPYDYALPTDGSPFGVTTELAPSPWNPHTRLLRI
GIKASDRAVAELAPANLVFLVDVSGSMDRREGLPLVKSTLKLLVDQLRDQDRVSLVVYAG
ESRVVLEPTSGRDKAKIRTAIDQLTAGGSTAGASGIQLAYQMAQQGFIDKGINRILLATD
GDFNVGVSDFDSLKAMAAEKRKSGVSLTTLGFGVDNYNEHLMEQLADAGDGNYAYIDNLR
EARKVLVDQLSSTLAVVAKDVKLQVEFNPAQVSEYRLLGYENRALKREDFSNDKVDAGEI
GAGHTVTALYEIVPAGEKGWLEPLRYAQAKAPQQSGKQGELAMLRLRYKAPEGGSSRLIE
RPISAQQPGSLAAASPDLRFAAAVAAFSQQLKDGRYTGNFSLADTVKLAQGAKGADPYGL
RGEFVQLVELAQSLQTQAPKAQAAQPVDLSQVQSRLE
Download sequence
Identical sequences A0A2C9EEA1
WP_015633702.1.27351 WP_015633702.1.76749 gi|501677654|ref|YP_007997480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]