SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9EI49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9EI49
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily Folate-binding domain 9.42e-58
Family Aminomethyltransferase folate-binding domain 0.0000297
Further Details:      
 
Domain Number 2 Region: 228-306
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000124
Family Aminomethyltransferase beta-barrel domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9EI49
Sequence length 313
Comment (tr|A0A2C9EI49|A0A2C9EI49_PSEPH) tRNA-modifying protein YgfZ {ECO:0000256|SAAS:SAAS00337442} KW=Complete proteome OX=1124983 OS=Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0). GN=PFLCHA0_c14800 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MADSAFFFPLSHEGVLAVRGPDASKFLQGQLTCNLNYLSDSQSSLGARCNQKGRMQSSFR
ILLESDGCLLAMARELIEPQLADLKKYAVFSKAKLADESASWARFGLADAQVALSGLGLE
LPEEDGSVARADGLIALRVSSQRAELWVPAERAASLRQQLAAQLPEGELNQWLLGQVRAG
LGQVMPETRELFIPQMLNLQAVGGVSFKKGCYTGQEIVARMQYLGKLKRRLYRLALPGDT
LPVPGTALFAPSHNSAIGEVVLAARAQQGVELLAVLQAEAVEGGELHLETLEGPTLQLLD
LPYQLDRDREIQR
Download sequence
Identical sequences A0A2C9EI49
gi|501678947|ref|YP_007998773.1| WP_015634516.1.27351 WP_015634516.1.76749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]