SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9K5N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9K5N4
Domain Number 1 Region: 890-1013
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.05e-40
Family Regulator of G-protein signaling, RGS 0.0000582
Further Details:      
 
Domain Number 2 Region: 1197-1279
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.08e-21
Family Ras-binding domain, RBD 0.0038
Further Details:      
 
Domain Number 3 Region: 17-98
Classification Level Classification E-value
Superfamily PDZ domain-like 5.06e-18
Family PDZ domain 0.0064
Further Details:      
 
Domain Number 4 Region: 1140-1209
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000669
Family Ras-binding domain, RBD 0.018
Further Details:      
 
Domain Number 5 Region: 288-422
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000203
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9K5N4
Sequence length 1847
Comment (tr|A0A2C9K5N4|A0A2C9K5N4_BIOGL) Uncharacterized protein {ECO:0000313|VectorBase:BGLB013614-PB, ECO:0000313|VectorBase:BGLB013614-PD, ECO:0000313|VectorBase:BGLB013614-PF} KW=Complete proteome; Reference proteome OX=6526 OS=Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail). GN= OC=Planorbidae; Biomphalaria.
Sequence
MYPNVNQHTKRRKKRVLQGTKTVVLVRGKVGYGFTISGQNPCMLSCIVPGSPADVAGLKA
GDLLYFVNGQNVSKACHDDVVRMVGLSTGSLELQVAENYNSSDSSDDDYPPRSKSRYPNR
IRPRVNPAVKASKYERAPPSYQRDRKENQLKHYIPAGAESDLSSSLTSQEDQAWAHVAEL
AWGKNRQEKFSSKKDSDRYEAKDVQHTGFVNGALQNGSVATAKKISLSAAIVKKVPQVAE
IKAPQQSDSEENIKKSVELTASNRDRPSVSPNGEINSDKQDINQQKSTNSAKAVVGYIGS
IETPSSHTRPHQRLQALRNAVRRLRLEKRVHTLVLMQVNPSGVTLTNSIGKQVAFYPHER
IAFSGICPDDERFFGLVTLSLPDDDCSSYTNGAESFKIPNSSCHIFMIEPELSPHSAHLQ
HAEAFQIHCTNSHEMYRCVEFPKSPTSLILCIANLYRDAPPRKFDTEIVQSQALADPMVK
LEQVNSSGNGNNSNSDSGLGFGREEAPIEQNEQVCIVELPYRMYQLNTSDTSNALDLSNM
STQGNLSPEVDVVNSTASSSSIQRPISAFDIRRGLNNSTSSEECWQQGSRPINKLTPRAM
PDPTQPSIKDTLFSNNISTENLRQSMQRLLQARQQQLQEQNCLLGSDGESHAGDPILSLS
VADDGHAILEAANVNPVKHHKFVAPVSVPSSSIQTFRSNNVRSAFQVPRPVSAPLSKQRA
QSKPETIDVETLGKLSPRAFPPTSPTSLVFRSPSAPPAPFFPHQDSDEDDDDDNDGEEDD
DESEDDPYIRRILEQFRKDRNAALEEDNRRLSEGFALSKKQREKQEVGNIQKWTKAGSFR
RTHQMMLKQSFSHSHESLAVGEESSNKLITASSVNNISKQTAEQGRIDTAGRVASWAVNF
EKLLKDPIGIGIFTEFLKKEFSEENIIFWKACEQYRMLADEHQRKVKAKDIYTRYLSTKA
SDPVNVDSAARTYSEKYLENPTAIMFDVAQQQIFQLMRQDSYARFLKSDMYKTKLMEEME
GKPLENPGENSTESDGKKKVKGKENDDKRRRSILPWKNSKKSSKASSQTEQKGQGKKEKE
ASKPQLNVSMASLPSTSTVTNSNGNNNLKKAPGPGIDLSTMRKEVFNAKESCGNTETHFK
FCRIVMPDGSTTVVCAKPGQTCRSVLSKLCEKRSISIASVDVFLLGSDKPLDLNEDISTL
GSKEIVIERRVLFRLDLPNGKSIGVKAKPNRSIRDVFKPILTKYGYHIDNIGVHFMGFQD
FLDLNTSVSELDNQRVVIVHDIDTAVARLCRCSHHKKILRQGVQPVALNPTKVPPANRLK
SGHRGGSLEEITNKIFEDLMRGKSQLAHGFDELGVLELDKAKVHKNEEGRYLGLFGLLRK
ESTAIKDIHKGNKSKGKVTFTLPKSDVKKKVSTKEGERLIDMLSSAQKLRLEEQRGIHVS
TGDLPSFLLEGNGPQETMDSLKDSQINNLNQSHPSGVAMFDDIEEISKVGFLEKTKRKEQ
LNYLGTTPEVVHGNHKMSRDTHKYSDKTVLSDKWKSLTGRSNHDNWTGRSSQPDNSLLNM
KNSFSNQESAVVTSQQTDNYLPMSPLIIDSKNDSHPLHSNGKCSTNARTTQSSPEILSDL
NSSNLKTLDRLNSSVTQNSPLKIKVPSDSYTSNKLKERNKTPDPPSYHNAIRTHGVDKKH
HPRSTDNVMAHTVNSVNHAENSSSFDHRVLVSPKSDEMIQRDVNDMSRRSLVSPRNDKPP
YPSQRNTPLLASSPKLNIGATPSSNFYTTTNQRNSPQSASSHKFHIGATPTSDSHTTTLP
NKRSATPVNLRSTGKWDLQFVNSPHATAFTLSPYRDSDHEEETVTFV
Download sequence
Identical sequences A0A2C9K5N4
XP_013063071.1.17457 XP_013063072.1.17457 XP_013063073.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]