SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9U3B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9U3B5
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000196
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9U3B5
Sequence length 94
Comment (tr|A0A2C9U3B5|A0A2C9U3B5_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY23826.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_18G110500 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MEKLDYFHVFGAQKSMKDQALVKDHILPFMSSETLEKIRGEGAKFCFWDCDTKTQLNVAL
KDWHTSKSYIFKKGWLNTFVKRRNLVKGDLIGIY
Download sequence
Identical sequences A0A2C9U3B5
cassava4.1_026234m|PACid:17989442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]