SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9VCB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9VCB4
Domain Number 1 Region: 117-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-29
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9VCB4
Sequence length 705
Comment (tr|A0A2C9VCB4|A0A2C9VCB4_MANES) Auxin response factor {ECO:0000256|RuleBase:RU004561} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_08G007600 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MITFMEAKERVKEVEKCLDSQLWHACAGGMVQMPAVNSKVFYFPQGHIEHASSPVDFRNF
PRVPPYILCRVSSVKFMADPETDEVYAKMKLSPITGSEPGLEEEDERVINGGEGQENKPA
SFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTILAKDVHGETWKFRHIYRG
TPRRHLLTTGWSTFVNHKKLVAGDSIVFLRAENGDLCVGIRRAKRGIGGGPESSWNPAGG
NCVMPYGGFSSFFRDEENKLLRNGNGNGNSSGGNGGLMGKGKVRPESVIEAATLAANGQP
FEVVYYPRASTPEFCVKASLVKIALQIRWCSGMRFKMAFETEDSSRISWFMGTISSAQVA
DPLQWSDSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPAIHLSPFSPPRKKLRFPQH
PDFPLDGQFPIPSFSGNLLGPSSPFGCLPDSTPAGMQGARHAHCGLPLSDLHLSKLQTGL
LPAGFPPLLDHVATHTRTSNSPMIQKPSMSENVSCVLTMSHSTQTSKKTNDTKTPKLVLF
GQPILTEQQISLSCSGGDTLSPVHTGNSSSEGNLDKMANFSDGSGSAALHQQSLPERSSC
EGFQWFKNNSRENETSLETGHCKVFMESEDVGRTLDLSLLRSYEELYRKLADMFSIENSE
TLNNVLYRDVTGAVKHIGGEPFSDFMKTARRLTVLMDSSSDNVGL
Download sequence
Identical sequences A0A2C9VCB4
cassava4.1_002684m|PACid:17967245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]