SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9VHR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9VHR3
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000114
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9VHR3
Sequence length 133
Comment (tr|A0A2C9VHR3|A0A2C9VHR3_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY44930.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_07G017300 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MSHSKEIIGDISNGAKVFSKQLGKTDKSHQLILPTKVLEQFPIQKGFYERDFTAFDGKGV
KWDFVLAIRHTGEYDKPFLRQSKWHEFVVAHDLYEEDIDYGIVFYINNEGKMQVTGLRRS
PYTLLGQPIWQQI
Download sequence
Identical sequences A0A2C9VHR3
cassava4.1_032427m|PACid:17962609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]