SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2C9W1J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9W1J3
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.09e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.0009
Further Details:      
 
Domain Number 2 Region: 146-230
Classification Level Classification E-value
Superfamily S13-like H2TH domain 5.1e-25
Family Middle domain of MutM-like DNA repair proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2C9W1J3
Sequence length 399
Comment (tr|A0A2C9W1J3|A0A2C9W1J3_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY52781.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_04G110800 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MPELPEVEAARRAVEEHCLGKRIKKAIIANDPKVIDGVSSSDFESSLVGKTVISALRKGK
NLWLQLDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAINDSDEWPSKYSKLFIELDDGLEL
SFTDKRRFAKVRLLKDPGSVPPISELGPDALLEPMKFDEFYESLHKKKMGIKALLLDQSF
ISGIGNWIADEVLYQARIHPLQTACSLSKESCVTLHKCIKEVIQYAVQVDAECSHFPLEW
LFHFRWGKKPGTVNGKKIDFIAAGGRKLSGGQAVKAAGALQRKTPNGKKGEDDDEDEVED
DANEAGSEEEEEEEEEEATRKAKSKRELKSRVHVKKPPTKQKSKASHENDNAAADDNGDD
GKDGKQKPRRATSDKQAKAKRESNKKATNNSRKPKKKVK
Download sequence
Identical sequences A0A2C9W1J3
cassava4.1_009072m|PACid:17962978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]