SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2D0QNY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D0QNY3
Domain Number 1 Region: 704-852
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.71e-38
Family Regulator of G-protein signaling, RGS 0.0000822
Further Details:      
 
Domain Number 2 Region: 1033-1122
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.48e-28
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 6-97
Classification Level Classification E-value
Superfamily PDZ domain-like 7.45e-21
Family PDZ domain 0.0082
Further Details:      
 
Domain Number 4 Region: 226-367
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-19
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 5 Region: 979-1047
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000227
Family Ras-binding domain, RBD 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D0QNY3
Sequence length 1170
Comment (tr|A0A2D0QNY3|A0A2D0QNY3_ICTPU) regulator of G-protein signaling 12 isoform X2 {ECO:0000313|RefSeq:XP_017320019.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=rgs12 OC=Ictaluridae; Ictalurus.
Sequence
MFRSSEASRRRANGQALGRVRGVEVARGRTGYGFTLSGHSPCVLSCVLKGSPADYVGLRA
GDQILAVNDINVAKASHEDVVKLIGRCSGVLHLLISESGQLDSCSSDEELGFHEHKSHWL
RPKMDSKTLGINRAERVVAEMQSGGIFNMIFENSSSHSSSSSEKAAAKRRPNSELDFLCG
DSEAQRSDVNLLSEQELARVLRDDSVFVDVFEPERQEADSAGILNVGMIVGYLGSIELAS
SGANLESDSLQAIRGCMRRLRAEHKVHSLVLLEVLHDRVLLRNERRAILAAYPAEKLAFS
AVCPDDRRFFGLVTMQAAEDHGMSAIADEDQGSRTSCHVFLVDPELCHHKVHQGISRRFG
FNCTPDPDTGGCLEFPSTSQPLLQFVSVLYRDMGESIEGVRARAFLDGDLDAQQNNSTSS
NSDSGIGNFLPEEKNNRVLLVDLGANPARHMPTGLWESAQGCRNPSAQAGLPSPPPPPPP
PPSITHRNGYRHEFSEPHPHSHTDPPPLSSRHLSSSSRLDVSGLPTRHHFPAHSKKGAGG
QRWLPVHVMREWHQGRSSDQESYSESTDGWSSANCSTLPPPMSKIPADRYRAARDIASQP
YRLHAHKDEWANKLFGTEKHFCEQQQLPQQHNGKRAKDSEKKGGRFRGVTMGFPQRSSGR
RSFGRSKRLSVSHSLDDLESAAVSDGELNSADLKGCGSDNSLNSNASLPSVQCHRRHPER
RVAAWAVCFERLLQDPVGIRYFSEFLKKEFSEENILFWQACEFFSHVPETDKKQLSQKAR
EIYNSFLSSKATTPVNIDSQAQLADDILNAPRPDMFKEQQLQIFNLMKFDSYTRFLKSFL
YQECMLAEVEGRPLPDPHHIPSSPTSKHSTSSERSNLSTPKKEEKKSKSVKALNEECKDE
HSDKKKGSLFPWPRNRSFGKGHKKKDLGEYTFSGNDGRRESQGSLSSGASLELGNSASGK
NEGEVSRNSMSLSERAVRYCNINLPDGSCCSVPIRPGVSIREVLLGLCEKLCINLAAVDL
FLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVV
AKYGLHLGDLVARISGEKEPLDLGLPISNLDGLRVVLEVDEHGGAAKDKQKLTLTKSHGP
PLSTRSQSATNSSSSYPKHRATELTTSGVC
Download sequence
Identical sequences A0A2D0QNY3
XP_017320019.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]