SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2D0RC60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D0RC60
Domain Number 1 Region: 666-790
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-38
Family Regulator of G-protein signaling, RGS 0.0000985
Further Details:      
 
Domain Number 2 Region: 974-1072
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-27
Family Ras-binding domain, RBD 0.0014
Further Details:      
 
Domain Number 3 Region: 10-99
Classification Level Classification E-value
Superfamily PDZ domain-like 1.12e-19
Family PDZ domain 0.0089
Further Details:      
 
Domain Number 4 Region: 219-357
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000228
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Domain Number 5 Region: 921-988
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000827
Family UBX domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2D0RC60
Sequence length 1362
Comment (tr|A0A2D0RC60|A0A2D0RC60_ICTPU) regulator of G-protein signaling 12-like {ECO:0000313|RefSeq:XP_017328132.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=LOC108268015 OC=Ictaluridae; Ictalurus.
Sequence
MRALEPAGGVKRSLDFSLAPKVRSVEIERGRAGYGFTVVGQAPCVLSGIMKGSPADDAGL
KPGDCVLSVNGTDVSAASHETVVELIGSSLRSLSLLVSSVDRHSVNFASGSLVFQGKQKE
TWSNTGQVESYEEGIGESVGSFNTVLEISGQACTNASKKQPKQRPRSEPDMSYWSHWCPS
KHNPHALDREEPSRVVSKDSVFSDFQSQHDILPDSSALNVGMVVGYINSIELDLVISHSE
KETLRAIRECITQIATEQKTHYLVMMRVKCNCVQLCDDRDVVLAAYPAENLVLCAVCTED
NRFFGLISNEVMKTGPKKAEQSTCMKTLCHVFIIDPELCDHDDHKSISDHFGFSCTADSD
TQGCLEFPHTPYSMLNFVSVLYTDMGDHIEKLRVKLDSEDCDEQQSTRNSGSGDSGIGNV
SPEDQESFADQWSLTSPNSSHTTWDKPSPCISQQSNEPSLRPERRCLLAEPFPVPATPQT
NASIGEEVSHSVPLNSISQCKQSQLPENKTKRRGSQRWPSVSIRARWQKPRPTSIDSLAD
SDTGGPKAKNSTLPPAMEQIPPLRYKTPGDLAYDLTLKLFNSGSKNKDGENKGYRFWGLT
RGRSVRKTARTNRLSLARSLDDLETAASGGERGGMERHGFGSINSLESNSSLPSVTNHHN
LSERRVAAWAVSFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEFFSQVPEHDKKQLS
QKAREIYNSFLSSKATTPVNIDSQAQLADDVLTAPRPDMFKQPQLQIFNLMKFDSYARFL
KSSLYQECMLAEVEGRPLPDPYHVPCSPAPSKHSFISEHSAFSTPKKDTRKPRTGRSNDD
LRDDPDRRNGIFSWYRNRSFGKGPKKREITDFNYNSNGRRESQGSLSSGASQEFNTPCST
LRNEQRNSTCERDKLGASRSCTVALPDGSSCCVCLKQGATIRQVLLELCQKQSINMAAVD
LFLVGGEKPLVLDQDSMTLSSRDLRMEKRTLFRLDLVPINRSVGLKAKPTKPVAEVLRPV
VAKYGLCLNDLVARISGETEALDLGLPISNLDGLRVVLEHSEPSSSNEKTKTLPSKTQGP
SLTSRGQSTPGDHRSSEKPVKGERGDKPPISETAQKKKANKIPLDDAEEFFELLSRAQSS
RADDQRGLLRKEDLVLPDFLRLKPEPSAPPSCSTPTSQKYVYNSVQPPSVTSNGHKPEAG
DETDPLALPLSPIHRAQGPPGQDGEGLCDLTLVGEGDISSPNSTLLPPVPTCTPPHDANI
TPPPLPSTHRNPSSGAVDESETPASHQQEKTPAQKDSQSSKQRTDGDDVPQDESFEGYAA
ELRQCQNKMRTGTYSSVHPPHALNNVSHGSQNSTTQYKATFV
Download sequence
Identical sequences A0A2D0RC60
XP_017328132.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]