SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2D0ST72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D0ST72
Domain Number 1 Region: 249-382,412-480
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.1e-32
Family Hemopexin-like domain 0.0013
Further Details:      
 
Domain Number 2 Region: 25-64
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000981
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 66-105
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000301
Family Somatomedin B domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D0ST72
Sequence length 481
Comment (tr|A0A2D0ST72|A0A2D0ST72_ICTPU) proteoglycan 4 {ECO:0000313|RefSeq:XP_017345893.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=prg4 OC=Ictaluridae; Ictalurus.
Sequence
MMASWTLISSVLLIACMLLQHCATQTSCRGRCGEPFSRGKICTCDNDCLTYNECCKDYEE
VCTYRGSCRGRCQEAFRRGRECECDPDCTLYNSCCPDYNTHCDMNYSAPEVRINKMSGAC
ADGSFRSALPHGQDTPDAIVDGGSVVELLPLTEDLASHLPADANLHLTLPPAIPVENTAG
PAHAGAFSPGEPFADVQVSISISGQASEVPNQHSGVSELLAGRPSTLTDIAQALEAASTA
GLPHQNSSPDLCNGLPINGVTSPFNGSIIVFQGHFFWMLDPKTRAAGPARSITADLGIPS
PIDTAFTRCNCEGKTYIIKGDNYWSFQNGVMEPGYPRSVSKDFGGLSGSIVAALSVPATR
NRPEMVYFFKKGGMVQKLTYPAGSGPICTGKKGKNPISAKNRQPVRLSGEININLKWKGF
PTPVTSALSMPNPRKPDGFEYYVFSWPKVFSIKISSDIPVLVSPAKPSAENDVRTWLSCP
Q
Download sequence
Identical sequences A0A2D0ST72
XP_017345893.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]