SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2D9H3P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D9H3P2
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.13e-70
Family Protein kinases, catalytic subunit 0.000000112
Further Details:      
 
Domain Number 2 Region: 480-538
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000406
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 413-474
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000903
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D9H3P2
Sequence length 589
Comment (tr|A0A2D9H3P2|A0A2D9H3P2_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:MAO80541.1} OX=35761 OS=Nocardioides sp. GN=CMH82_07765 OC=Nocardioides.
Sequence
MAEVRKGTDNRLGRVVAVKRLRTDLASDATFQARFRREAQSSASLNHPAIVAVYDTGEEP
AADGSGVAQPYIVMEFVAGRTLRDILREGRKILPERALEITSGVLSALDYSHRAGIIHRD
IKPGNVMLTPSGDVKVMDFGIARAISDASSTMTQTAAVVGTAQYLSPEQARGETVDSRSD
VYSAGCLLYELLTGRPPFVGDSPVAVAYQHVREQAQPPSDHDTDLPPEVDAIVMKALAKR
VEDRYQSAAAMRSDIERYLAGRPVQAAVPPPVPGPATAATAVAARPVPAAAPGPGPATGT
HTAIPYAEDERRTPVGFLVLLGLLVIALVVAGALLWPRLFPAAPDEVRVPDVVGRAEKQA
RTTLGEAGFEVAPTQFETSDRPAGKVIEQDPSGDSFVDPGSTVTITVSSGPPEVTVPDVV
NQQRDQATATLEAAGFEVDVTRGESDEPRNEVLAQSPEAGLDVAEGSTILLTLSDGPESI
PDVIGLDQEEAEKRVRDAGFNPVVREDNSSTEPKGTVVDQSPKGGQKVPQQTDVNLFVST
YEEPTEEPSPTEEPSPTDPTESPTATDSPSALLGGNGRSVPRGRRSPRA
Download sequence
Identical sequences A0A2D9H3P2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]