SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5C2E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5C2E3
Domain Number 1 Region: 145-412
Classification Level Classification E-value
Superfamily Pseudouridine synthase 6.47e-66
Family Pseudouridine synthase I TruA 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5C2E3
Sequence length 488
Comment (tr|A0A2G5C2E3|A0A2G5C2E3_AQUCA) tRNA pseudouridine synthase {ECO:0000256|RuleBase:RU003792} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_11400015v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MAEGEIETSDFQYPISITKENFKSNGEGFIINLKNQLKTLENRVKELELENAKLSSQLSN
CRCRNKLVENVNYYVAHGNTLIQESKKLSVGGEKVRLFPTKGVSKDVSHEDAVGHEEKSN
VDETKEFESKERSPGCITKSIHHAPKRYVAMKIMYFGQRFYGFASQQVEPTIESEIFKAL
EKTRLLVCDKNESRYTRCGRTDKGVSSVGQVVSLLLRSKSGDTRVNGDHEKLSPEDMCGE
IDYVRVLNGVLPKDIRVISWCPVRNDFHARFSCLRRTYKYLFWRGNLNLSEMEIAGMKFV
GDHDFRNFCKMDAANVHNYRRHITSFEFSRCNSRSESDELWAMTIIGSAFLWHQIRCMVA
VLFMIGHGLELPSVIDELLDINRTPRKPQYVMAPELPLILQSCEFERLKYICSPDASQSL
REHLKNEIRHYELQAAIFQEALLSCSHAINDHSPSSHIKKKAAHIPLMSRPTEPSYEERQ
AKQKARTV
Download sequence
Identical sequences A0A2G5C2E3
Aquca_114_00015.1|PACid:22024757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]