SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5C511 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5C511
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 8.5e-16
Family Ribosomal proteins L15p and L18e 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5C511
Sequence length 95
Comment (tr|A0A2G5C511|A0A2G5C511_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA26350.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_09400009v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MTTGLKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVEIKD
KATPENAPLIDVTQLGYFKVLGKDLLIDCAVAVEC
Download sequence
Identical sequences A0A2G5C511
Aquca_094_00009.3|PACid:22032645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]