SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5C7S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5C7S4
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.1e-34
Family Quinoprotein alcohol dehydrogenase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5C7S4
Sequence length 196
Comment (tr|A0A2G5C7S4|A0A2G5C7S4_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA27305.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_08100033v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDYLENIGGMWGWHLVCGLKWSYDNCQLASGENDNRLFVWNQHSPQPVLKYCEHTAAVKA
IAWSPHLNGLLASGGGTADRCIRLWNTSTNSHLSCMDTGSQVCNLVWSKNVNELVSTHGY
SQNQIIVWRYPTMSKLATLTGHTYRVLYLAISPDGQTIVTGAGDETLWLWNVFPSPKSQN
SDTDIGASSLGRTQIR
Download sequence
Identical sequences A0A2G5C7S4
Aquca_081_00033.1|PACid:22040113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]