SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CCQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CCQ0
Domain Number 1 Region: 259-357
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-19
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CCQ0
Sequence length 806
Comment (tr|A0A2G5CCQ0|A0A2G5CCQ0_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA29050.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_06300016v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSCARKHSIVASQSWSHTLKNRSPLSVSNGISGQWWHSANARNVGTSQSDLQARLAYEFD
RSNGIERRVSSVPGIERAPKDPSERVAPSSDVPVHQRNPGGDMVVALNALRREEGTADAL
PDPRHLPGESSTVDARKGSIVEPHLNNSVAAKCFDTHANSRVNTQSSSGKDPLVPSNDAN
GSACVSGSQQQRQTPSPPMANQCHGNLQNGGDTYTENQIRNGKARGDGRGRNQLLPRYWP
KITDQELQQISVDSNKIITPLFEKTLSASDAGRIGRLVLPKKCAEAYFPTISQPEGVPLK
VQDAKGSEWVFQFRFWPNNNSRMYVLEGVTPCIQNMSLQAGDIVTFSRLDPDGKLVMGSR
KPSDASPSTQDSRKSKNGNGVSKLAESNLKDANTWSEIDKSGYIAKDALRAQSSVLPSKR
KSSTLGLKNKRLQIENEDRIELKLTWEEAQGLLRPACNHHPDSIVVVDGHEFEEYEEAPI
LGKPTIFTTNNSGENIQWAQCEECSKWRKLPVDALLPSKWTCSDNLWDPKRSSCSSDQEL
TDGQIQDLLSSSNDVASKKMKSAKKDSESVEGSEGGLDTLANVAILTEEALPSLAQPPTT
KHPRHRPGCSCIVCIQPPSGKGPKHSDTCVCNVCTTVKRRFRTLMERRAKRPPENEAGTS
RKKQQLVERVEPVDGLPTSSNAKSGVNPEMFVDGNDDDDISCRKPSSPFKGGIDLNIQPE
REDDASPVSGSGSIRFVRDSADLYHKQQKLPSSSRNRDVNTSGGSAEVGGVENHGIGVPQ
SCDPENGELNPPAPRPTWIPATSGTG
Download sequence
Identical sequences A0A2G5CCQ0
Aquca_063_00016.2|PACid:22042610 Aquca_063_00016.3|PACid:22042611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]