SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CH97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CH97
Domain Number 1 Region: 328-366,437-660
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.5e-52
Family WD40-repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 75-125,272-369
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000196
Family Quinoprotein alcohol dehydrogenase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CH97
Sequence length 807
Comment (tr|A0A2G5CH97|A0A2G5CH97_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA30655.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_05400035v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MGLSNDPLLSRNNHDFDIGRSASDDHLCRRQPHIDIGIDSDCFIVRSKSDGSVTTTTTSD
HCNHSSISSSIHSVESVSKNVSFLDDNSNVYVSSNGSSTAATNNSNKPPTGRNLRRMERI
RPFWTNLNPNCNKDLRDSSLVRVDGNGEECAVNSDCIGGGNHSDMFCKIKNLDNGKEFVV
NEVREDGMWNKVREIDTGHQLTAEEFESCVGHSPIVQELMRRQNVENLEAKKDEFEVNEN
GGTGGGDNGSKSKKKVSWLKTIKNVASAVTGHWEKRNSVEWDSSSDKVGRRSSSGTEDGQ
NTSFHCPEKVRVRQYGKSWKELTALYKNQKIQAHNGSIWSIKFSLDGQYLASAGEDCVIH
VWQVIESDKRGEFLVEKSDDGSLNPFFLVNGSPELTLVPSLADTHLEKKRRSKVSISRKS
VNLGHVVMPDSVFALSETPICSFRGHLDDVLDLSWSKSQYLLSSSMDKTVRLWHMDSHAC
LKIFSHSDYVTCIQFNPIDDRYFISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAASYTPD
GQGALVGSYKGSCRLFNTSENKLQQKSQIDLQNKRKKSHLKKITGFQFAPGRFSEVLITS
ADSRIRVVESTDLVHKFKGFRNANSQMSASLTANGKYVVCASEDSCVYVWKHESNSRPGR
NKGVTVTRSHEHFHCQDVSVAIPWPVLDVTTGTGEQNRLMDDMSGVEHFSPQAESDQHRT
SPLLYGSTNGTQHDTVSNVNNSYFFDRFSVTWPEEKLPVAGRNQIARSFDLSNGMTQDRA
ALGMVIVTASLKGEIRVFQNFGLPVHV
Download sequence
Identical sequences A0A2G5CH97
Aquca_054_00035.2|PACid:22037081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]