SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CN84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CN84
Domain Number 1 Region: 6-241,290-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.31e-63
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 504-644
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00029
Further Details:      
 
Domain Number 3 Region: 248-326,369-430
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-23
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 739-796
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000266
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CN84
Sequence length 797
Comment (tr|A0A2G5CN84|A0A2G5CN84_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA32763.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_04300004v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MHFAKLDDSPMFRKQIESLEENAESLRERSLKFYKGCRKYTEGLGEAYDGDIAFASALET
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLIHFVNIDLQDVKE
ARKRFDKASLVYDQAREKFLSLRKGTKIDVATMLEEELHSARSTFEQARFTLITALSNVE
AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALTER
MQDYQRQIDRESRWSSNGSHGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLS
KRSSNLRGDWKRRFFVLDSRGMLYYYRKQWTKPSGSGAQLSNHRSHSSELGSGLLSRWLS
SHHRSGGGVHDEKSVAHHTVNLLTSTIKVDADQSDLRFCFRIISPSKNYTLQAESAMDQM
DWIEKITGVIASLLSSQAPMQRLPLSPMRSGHCHSPSESSSFESSSSFDHPTIEDFASEK
NHITGHHERSGRSAHQHRLSMKSEKPIDVLRRVCGNDRCADCGALDPDWASLNLGILVCI
ECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNTYANSIWEELLNSRNTSLPDD
STTRSPLSDSHQLHPISKPSYSDPISIKEKFIHAKYAEKLFVCKPKAQHLLSLANHMWDS
VRTNDVKAVYRCIVNSETDVNAVHGQASISSSLTLAKAMMLHEHPDHSSCLPEDSLDKPL
GASSLNTVSTSGDKNVEECLDGCTLLHLACETADIGMIELLLQYGANVNAPDSRGQTPLH
HCILRGRTVLAKLLLSR
Download sequence
Identical sequences A0A2G5CN84
Aquca_043_00004.3|PACid:22045068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]