SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CQF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CQF8
Domain Number 1 Region: 117-158
Classification Level Classification E-value
Superfamily F-box domain 0.000000113
Family F-box domain 0.0049
Further Details:      
 
Domain Number 2 Region: 6-107,232-441
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000306
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CQF8
Sequence length 473
Comment (tr|A0A2G5CQF8|A0A2G5CQF8_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA33544.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_04100168v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MFGCVDNLAHTCDVFKLDISTMDWVRVNSLGDRIFLLGLISSTSLSANESSLKANCIYFS
LSGGTRLYMFDMHDGTITTILPCPKIPYWRGPFWVVPNCKPQVKKDMVNLEESIQQGGNQ
EWSWKDLPVELLELIVSFLFLGDCIRFRLTCKSWISITPPLRSNCVFNKFESEPQQLVPW
LMSFPKNNQGIWKLHHPIYGDAYTMNIPELAGAIIRNAKYGWLLMSRGTSFFFFNPITME
VVKLPDMEEDYEFIGMSFSSPPTSSDFVVFGFLGFYMVVYRKGEEKWSEDCFKTHWEFLN
SPCNPIFYDGVFYCLGKNGRLGLFDTKVITEEPQWRIVESAVFSISLKSDLINSSETFIV
EYDGEIISIFVSHQGQQISIFKLDLSNLKWCRLESLDDKVLFLSHTASMLLPTVGLKGIE
NRIYFPRFHETDNMFYSLSTRKYHCCGSQYSSEDWINTRQLSHTQCTWIQSTN
Download sequence
Identical sequences A0A2G5CQF8
Aquca_041_00168.1|PACid:22029247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]