SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CRI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CRI1
Domain Number 1 Region: 503-788
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-80
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 104-180,207-233
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.1e-29
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 
Weak hits

Sequence:  A0A2G5CRI1
Domain Number - Region: 381-418
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00392
Family Pan module (APPLE domain) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CRI1
Sequence length 835
Comment (tr|A0A2G5CRI1|A0A2G5CRI1_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA33921.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03900046v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MCQVHVVVLSLVILNFIIFSTNAQPFDYPIANLSNTWTNNPSIEHSVDFGDGSKVRSILL
RGTFGPRFACGFYCNGNCTSFLFAIFIVQTNSASYITSPAIGFPQVVWSANRNNPVQENA
TLQLTENGDLVLRDVDGTLVWSTNTTGKSVVGLNMTEIGNLVLFDRSNKTVWQSFDHPTD
SLVPGQSLLVGQKLTASVSSFNSTEGGLFSLSVTAEGLFAYIESNPSQIYYESRIGGTTT
RYVKFMNGSIAFFKSTSAPNQPFSTVIRVPLASSAQYIKLVSDGHLKVFEWSSEWKEVAD
LLTGYLGNCKYPLVCGNYGICSDEQCGCPGITGNEQIYFRLINDRQPNDGCAAITPLSCE
TPQDHQLLDLEDVTYFYFPANITNTDIESCKQACLNNCSCKAALFQYGPNVSDGNCFLPS
QLFSLMKNEKDKTHYNSSAFIKVQASQTEFVPPTSQTKSTSTGIILGSSLGAFSGLLLII
SISVVLFRIKKAHDEKDEEYLDQVPGMPTRFTYEDLKVATGSFLKKLGQGGFGSVFEGTL
VDGSNVAVKCLDGIGQVKKSFLAEVETIGSIHHVNLVRLVGFCADKSHRLLVYEYMSNGS
LEKWIFNRNNESSLSWQTRRKIILDVAKGLTYLHEECRQKIFHLDIKPQNILLDDNFNAK
VSDFGLSKLIDKDQSQVMTTMRGTRGYLAPEWLNSIITEKVDVYSFGVVVLEIVCGRKNL
DYSQPEESMHLLSVLKRKAEEDRLFDMVDENSKDMLIHKKEAVEMIKIAVWCLQSDFTKR
PSMSVVVKVIDGLMEVELNLDYTFSTTVTPTAMIQQEAKLGSSTPLLASVLSGPR
Download sequence
Identical sequences A0A2G5CRI1
Aquca_039_00046.1|PACid:22062102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]