SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CSA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CSA2
Domain Number 1 Region: 158-447
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.19e-46
Family WD40-repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 128-152
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000014
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CSA2
Sequence length 452
Comment (tr|A0A2G5CSA2|A0A2G5CSA2_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA34172.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03800031v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDLDNGGGKRVFTRLGGGGGGGGGHTQSSHMEPKVCFHWRAGRCNRNPCPYLHSELPQHS
NSNVKRGYGNGLPDNNNNHNNNDRSFAGQGFARRKPNNSNQQVNNKWGRGHGGSGAGGVG
AFRPPPKVQDKICHFWIDDKCSYGDKCRYLHQWFTSDSFTMLTQLPGHEKVISAIAFPMG
SDKLYSGSKDESVKVWDCQTGQCAGVVNLGGEIGCMISEGPWIFVGIPNEVKAWNTQTNT
DLRLSGPVGQVYALVVGNGMLFAGTQDGNILAWRFSATTNCFQPTAALKGHTLAVVSLVV
GANRLYSGSMDNTIRVWDLETLQCIQTLTDHTSVVMSVLCWEQFLLSCSLDRTVKVWAAT
ESGSLEVTYTHKEEHGVLALCGMHDAEAKPVLLCACNNNIVHLYDLPSFNERGKIFSKEE
IRAIEIGPGGLFFTGDGKGELRVWKWSETAPA
Download sequence
Identical sequences A0A2G5CSA2
Aquca_038_00031.1|PACid:22026864 Aquca_038_00031.2|PACid:22026863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]