SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CSK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CSK4
Domain Number 1 Region: 17-127,580-731
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.3e-22
Family WD40-repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 17-317
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000128
Family WD40-repeat 0.016
Further Details:      
 
Weak hits

Sequence:  A0A2G5CSK4
Domain Number - Region: 1001-1113,1223-1300
Classification Level Classification E-value
Superfamily ARM repeat 0.000617
Family PBS lyase HEAT-like repeat 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CSK4
Sequence length 1301
Comment (tr|A0A2G5CSK4|A0A2G5CSK4_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA34274.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03800098v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MKCEAIACIWSGAPPLHEITATAVLNEPPTLYTGGSDGSIIWWNLSTSYSNQSNKEIWPM
AMLCGHATTIADLDICVPTTVDAQEEKEISSNVVMNSTSSGYGALISASTDGMLCIWSRN
SGHCLRRRNLPPWVGSPSSVSTLTTSPRYVCIACSSVDTAHSSSQQTMEHVETGESMVDR
EFQHRSAWTKYAVVIVDSYSLNIVRTVFHGGLSIGQLKFMAVVPSGKYMEVSSVVLADVY
GKMQSIILLEESDQDRDGKTNMVRSSSHSMMSILSDVSSDGDQVVSISAHGRLLVLVYRS
RCIFCLVDNGIAVGEISLSDGPLCDDGLPLQSHVIGGMFLVWDKDGKVLDTEEQQKEFTE
SFLIWNNKGAALVYQISGSDHTFNFELSCEIPAVTHDLDVKLTIRFCHINSFILRIESTC
FIVEESLFWKPHITVWSLSDQNDPHRKLDLQGTMLGEGGILGEWTKSSRLFSMNGSCKYN
ANVISISGEIQEASHENGGPILTVANGCYGEGKNNSLVLKENTVSSSMVLFERFCAPYAI
VYGFFSGRIEVVHFDISFQELNSSGSPHHEVKPHVSKQYFSGHTGPILCLAAHQLVGAPS
ARSFSKILVSGSMDCTIRLWDLDTSDLITVMHHHVAPVRQIILPPAWTDRPWNDCFLSVG
EDCCVALASFETLRVERIFAGHPIYPSLVVWDGARGYIACLCKNNSGISDAVDVLCLWDV
KTGSRERVLRGPAAHSMFDHFCEGINLNFVTDNVLGGITSASSLLLPINADMSSQSHSKH
LEMGVSSSNTSQRTIIDLTQSTIAHANEGKSARHLPSAKVHQNNMHPVKCSCPFPGIATL
RFDLPSLMFPCQNHSQIFENRGKIENELLSHKGPQTPSSFIPTSNDISDTQENEKGPMEE
HEWLKFVEGCILRLSLSFLHLWGVDHELDGLLISEMEVNRPQNFIVASGLQGDRGSMTLT
FPGPRATLELWRSSSEYCAIRSLTMVALAQRMVSLSLSSSAASSSLAAFYTRHFSEQVPD
LKPPSLQILVSFWQDESEHVRMAARSLFHCAASRAIPHPLCGQKLDQITSLPLSSGDLND
EQKPISTRETSASSSMEPFMTTEIQDDSQSEDSSILTWLESFEMRDWISCVGGTSQDAMA
SHIIVAAALAIWYPSLVKLKLAALVVHPLIKLVMAMNEKYSSAAAELLAEGMESIWKACI
GPEIPRLLGDIFFQVECVSGASANSATQNAVAAMTIREVLVGILLPSLAMADIPGFLHVI
ESQIWSTASDSPVHLVSLMTLIRVVRGSPKPLAQYLDKICR
Download sequence
Identical sequences A0A2G5CSK4
Aquca_038_00098.3|PACid:22026617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]