SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CTG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CTG0
Domain Number 1 Region: 337-382
Classification Level Classification E-value
Superfamily F-box domain 0.00000000353
Family F-box domain 0.0054
Further Details:      
 
Domain Number 2 Region: 239-313,480-620
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000942
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CTG0
Sequence length 693
Comment (tr|A0A2G5CTG0|A0A2G5CTG0_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA34177.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03800036v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSSTEVENMKVSKERSLRTLPPSTYNLSLVFSHGKKYRDQTFCTLFDQSYHVRSVPEMRQ
MWCVTTSYGWLLLKNMYSPECHLFNPVTLSKIHLPTLPSHAYSEAVLTSSPTDTNCVIML
FNIIEESLIFCRIGGTKWVEQSLKPINKNPITINGEISAINCKGKMYLFFWKGMAIIHDI
FDTFVSMELHDIKIPKFTHSNVTMVTRRSSYVVESCGEIFQVCLIFFGIELHIIQTVEVF
KLDLSTMSWVKVERLDDRIFLLGHCSTSISATEVGLKGNCIYFCCTKSTSLCKFDMDDGT
ITITIPGPRKFRYWSGPFWMVLDCKLQVKKDSARIKDSKDEGNQERSWKDLPVELLELIL
SFLSLGDCIRFRLTCNSWMSITPPFRSNNLLIQAESGFTLLPWLMCFPKKNQGVCKFYHP
IYSDCYTINIPELEGSIIRYARYGWLLISRGDTCTFFFNPFTMEIINLPDFDEKEDLQSM
SFSSPPTSSDFIVIGLSSYVMLVYCKSENTWRRYFLGSDLPYEFTLSACNPVFCGGLFYF
LCKGGKLGIFDPKGKNEDEVMVFQESEVFSISSPEYDSIKSIRNFIVECDGEILSVFVGY
RGKPISIFKLDNLKLKWSRLRTLGDKVLFLSHTGSVLIPAPLKGIENRIYFPRIQEKDNV
FYSLSTCHYHRFGCNNCREDWLNTTEYTKCTWI
Download sequence
Identical sequences A0A2G5CTG0
Aquca_038_00036.1|PACid:22026771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]