SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CVK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G5CVK5
Domain Number - Region: 48-75
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0034
Family Ypt/Rab-GAP domain of gyp1p 0.041
Further Details:      
 
Domain Number - Region: 105-171
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0196
Family Polyphosphate kinase C-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CVK5
Sequence length 261
Comment (tr|A0A2G5CVK5|A0A2G5CVK5_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA35312.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03500010v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MALKENRDFSQQFYTHIHTLVLYLVKISEGTLSKSMKSEKTAFIFVRFLWWFAKRFLHPD
VVFIYDYIFLWDEDLGVTNFDPGRFLEIMASEGLEISQPALDPNSSEVHHRITIRNRREK
VHRRVYAVQGSLNCSEESTGPPCTGWIEGMAPVFSRAAWRCLWHLIQNDLIHGWGLDMKL
GYCAQGDRTEKVGVIDSEYVVHHGIPSLGGPSENKTPAVRSLDLRTHVRRQSTAELEVFQ
KRWEEAVRNDEGWDDPFDNMK
Download sequence
Identical sequences A0A2G5CVK5
Aquca_035_00010.2|PACid:22061055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]