SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5CYR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5CYR7
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-26
Family Ankyrin repeat 0.00073
Further Details:      
 
Domain Number 2 Region: 573-626
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000073
Family RING finger domain, C3HC4 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5CYR7
Sequence length 631
Comment (tr|A0A2G5CYR7|A0A2G5CYR7_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA36412.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03400356v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MGQQQSQNKDKLLYQHVKNGNIEMIKALFLDGARLEWANKEGKTPLIAACLKARLYDVAK
TLLKLGANVNTYCPGTQAGTPLHHAAKSGLEQTVELLLSHGANASVTNYDCQTPMDVARA
KGYKNVVRTIENHICLFSGWLRELHVPGFLEESTCHSKSNYIWAVVIPSAFRSPTKPPKL
LLFIYCTQDAQPRSVILLWKAKIEEPEFHQLDPTFVIFDEQTETRYKFASEDEGDKQQLQ
CFYNACTGISQVLLHELQVIRSSIPQDSTPPIVPETAPPTTTEVVDLATGIKASIDSAMV
KKPPQYRPCHSPELNHTNGLIYRADENDNDWWFHLLGAAYPSKDCSSKRLNKPVNDMYNG
PSSSATKQRLPSDTPIMRSSIPQDSNLPIVPAFAPPTTTEDVDLAMGINASIDSAMVKKP
PQPRPCHSSGLNHTNGLIYRADENDNVWWLHLLGAAYPSKVCSSKRLNKPVNDMYNGPSS
STTKQRLPSDTPIMPENPGRIAIPSAPPIPDGADYGPEIDYNQLDLSGRIVIPSAPPIPE
DEDSVPETNSSPIDLPGQCLENKGARKNELKEDGNVSSACAICWDAPREGACLPCGHRAG
CMSCLNELKAKKCGCPLCRAKIQQVVRIYDV
Download sequence
Identical sequences A0A2G5CYR7
Aquca_034_00356.1|PACid:22056442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]