SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5D129 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5D129
Domain Number 1 Region: 605-747
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.76e-24
Family Pseudouridine synthase RsuA/RluD 0.0011
Further Details:      
 
Domain Number 2 Region: 535-597
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000000523
Family Ribosomal protein S4 0.024
Further Details:      
 
Domain Number 3 Region: 55-120
Classification Level Classification E-value
Superfamily F-box domain 0.000000471
Family F-box domain 0.0032
Further Details:      
 
Weak hits

Sequence:  A0A2G5D129
Domain Number - Region: 153-336
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0641
Family Galactose oxidase, central domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5D129
Sequence length 757
Comment (tr|A0A2G5D129|A0A2G5D129_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA37222.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03000068v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MESMVATDYPMVEIATNPKVLQEKLKKWSQSFFSNSTSNMETSKVRSPDTTADADWSGLP
KDLLQSICERLCIVDYLRFSAVCTYWRSIAVFPRIMLMVHNKEEPDIGNLCSLSSINDLH
NPLRNIKYEMYYGSLNGFMIKSSDWAGSKQGEIHLYNPVSGGRISLPSLPGTIPPIHIEK
AIVASASNSTDDFIVVVSIWFSNDILFCREGDEEWSWIVTRKYPMSLIDITYHQCKLYAI
FSEAIEVYDLQIRKCNKHCLIIKTTFPDSSFFELQKRSKRFRRDDRYYQVYLVTTPKEEL
LMVTKHTPSTGAYRTMTFKVLKLCEDDGSWYEVQSLGDQVLFLGKNSVCLMAHDVPECEA
NSIYFISSSTEFNGKCDTAAATAIAAVSSTLSSLHLSQSLFFFTKPSSFPSRNFKTFSLI
RASSSSKTEFNITFGTGTKESLKPNPLSEKSENPNTPSIPFLIPWIVRGEDGKLKLQSTP
PVHLLHDIANAKTTSTTPKKKKKAISSDKPVLKVEPKYSKAARRFYNENFRDPPQRLSKV
LAASGVASRRSSEALIFEGRVTVNGSVCNTPQTRVDPGRDIIYVNGNRISKKLPPKNKIN
QGFPKPRLFTVGRLDVATTGLIVITNDGDFAQKISHPSSGLSKEYIAAIDGVVNKRHLVA
ISQGTAVEGVHCKPDSVELLPQQPDVSRPRLRIVVGCTFLVHEGRNHEVRELVKHAGLVL
YSLKRVRIGGYRLPSDLGLGKYIELKQGDLKSLGGTV
Download sequence
Identical sequences A0A2G5D129
Aquca_030_00068.1|PACid:22035482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]