SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5D202 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5D202
Domain Number 1 Region: 298-410
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-28
Family LexA repressor, N-terminal DNA-binding domain 0.056
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000461
Family VPS36 N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5D202
Sequence length 417
Comment (tr|A0A2G5D202|A0A2G5D202_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA37545.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03000251v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MAGKWFPAAQLTSSGRPVFVTGEVESTLLSSVDLECEENSHVPLLKSGVLILTTHRLLWI
NETNTSSSAAAVAIPLGTVTHIFPPKKSMKHMFASPRVRFQVSTSVDGMVIENGQKSMVL
TLVLRGSKSDLDSFYSRFWEVWRGRSWEVLSLASSESTSMEGSSVVKTTVVGVSGILRRE
QEMWESTDKTLQDAFQDLNALMSKAKEMVMLAEKMRLKLLSGPASEPKANDEEMTSKQEM
QDWLLSVGIASPVTKESAGALYHQQLSRQLADFVKLPLERAGGMIALIDIYCLFNRARGT
ELISPEDLLRACAIWEKFDVPVMLRKFDSGVMVIQNKSHSDEEVFGRIKSLVSKPDALRT
GISPSDAAMTLGIAPAMAKEHLLTAESKGLLCRDISPEGFRFFINLFKEIDLNDIYS
Download sequence
Identical sequences A0A2G5D202
Aquca_030_00251.2|PACid:22036125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]