SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5D2J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5D2J4
Domain Number 1 Region: 118-323,354-406
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.07e-33
Family Nuclease 0.053
Further Details:      
 
Domain Number 2 Region: 438-559,605-691
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.62e-29
Family Polyphosphate kinase C-terminal domain 0.072
Further Details:      
 
Domain Number 3 Region: 3-104
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.51e-16
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5D2J4
Sequence length 763
Comment (tr|A0A2G5D2J4|A0A2G5D2J4_AQUCA) Phospholipase D {ECO:0000256|PIRNR:PIRNR036470} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03000342v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MTKLYATIDLGKARVGRTRMIKNVPARPQWNESFHICCAHTISNIIFTVKNGNPIGATLI
GRAYLPVEAVLSGNEVDLWLEILDVDRNPVHGGAKIHVKLQFLHVTRDINWSRGISTEFK
GVPHTFFKQREGCRVSLYQDAHIPDDYIPKIPVSGGEYYKPQRCWEDVFDVINNAKRLIY
ITGWSVYTEITLVRDPKRPKQGGDLTLGDLLKKKANEGVRVLMLVWDDRTSVPSFKRDGL
MATHDEDTENYFRNTTVHCVLCPRNPDDGRTLVQGTEISTMFTHHQKIVVVDDEVPNRGS
QQRRIISFIGGIDLCDGRYDTPSHSLFRTLDTVHQHDFHQPNFTGASIQKGGPREPWHDI
HCKLEGPIAWDVLYNFEQRWLKQGSGKDKLVRLKDIPNPVISPTPVTFAQDHEIWNVQLF
RSIDGGAVLGFPDTPEEAARAGLVSGKDNIIDRSIQDAYVHAIRRAKDFIYIENQYFLGS
SFGWQSNDIVVEDIGALHLIPKELSLKIISKIEAGERFMVYVVIPMWPEGIPESASVQAI
LDWQKRTMEMMYSDISLAIQAKGLLANPKDYLSFYCLGNRESKRMGEYIPTEQPEPNTDY
NRAQQARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLTNREP
AGQIFAFRIALWYEHLGLHHNCFAQPSSLECARLINQLSDRHWELYSRETLDGDDLPGHL
LSYPITVTNNGVVMELPGTKYFPDTKANVFGAKSDYLPPILTT
Download sequence
Identical sequences A0A2G5D2J4
Aquca_030_00342.2|PACid:22036023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]