SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5D2P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5D2P7
Domain Number 1 Region: 466-695
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000015
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 2 Region: 699-923
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000288
Family Tropomyosin 0.0015
Further Details:      
 
Weak hits

Sequence:  A0A2G5D2P7
Domain Number - Region: 912-1000
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5D2P7
Sequence length 1337
Comment (tr|A0A2G5D2P7|A0A2G5D2P7_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA37774.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03000359v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MEEPTQAESEIQVTKADSIDSGITHSNEVGAGKDEILTNGSLEHEEVEIKGQEEETALEG
EFIKVEKEALDLKESSDKEQVQKPSVVERSSSNSLESRDLLEAQEETKELKLELQRVADE
MKNSERESTLLKEELLNTKEKLEESLKHCEELEVNQKQKEELILDHEEKYKSQINTLQEA
LEAQEAQHKELVDVKEAFTGLTTELENSRKKMQELELDLQSSVGEARKFEEQSHQIGSHA
ETETQRALEFERMLELAKGSAKEMQYQTASLQDELKDLYKKIAESQQVEESLRSTTAELS
AVQEQFELSKSLVSDLQKQVASEEDVKNALNQELDSHKASDMRVKDDILALENLLSSTKG
DFQVKVAELEDIKMKLHEEVETKKMVEDRLKSQEENISTLQEELAKVVSEKVSLEAVVVD
LNTNVLQMKELAGDLETKLKLSDENFSKADALLSEALSNNVELEHKLKSLDELHQEVGSV
AASTTQKNLELEDILQASSAAAEEAKSQLREIETKLISNEQKNLELEQQLNMVELKSSDT
ERELKEIIEKTSELNVKLIGLEEEKVLLQNEKHEYQEKLTQLETALSQSSSRNLELEQEL
KDVAEKCAKHEAHATTTNQRGLELEELVQISESKVKDAGNKVAELELLGETTNYRIKELE
EQISTLETKSNDKEEEHKHLSDKVSELAAQLEIFQGKASHLELELQAANEKDKELSESLN
LALEEKLKFEDMSNSSSKKLSETENLLGVLQNELKLAHEKLEGIEQDLKVSGIRESEIME
KIRSAEEQLEHQGRIIEQATTRNSELESLHESLLKDSEIKLQEATANFTNRDSEANSLYE
KLKMLEDQKRTYEEQVAEANERSGSLKAELNEISLKLVAQENIIEELKGKVEEANNKTGQ
SISDNELLAETNLQLKSKIDELQELLSSSLAEKEATSHQLTYHMDTLAELTDQHSRLTEI
HSATESRVREAEVQLQEAIEKFSQRDSEAKDLNEKLHALESEIRLYEETANEASATAQKQ
KSELEEAHLKVKHLDSVLQDLQSKASQIEKDNEELAVTNLRLTQELVAHESKVSAIIEEN
NTLNETYQIERKELQEVINKLEGQKNEQKESEDSLKAEAESLKAELAEKSVVGVHVVELK
QQLALLEARIKEEKESDLLKESEREVISKNSLEELESKCKQVLLLEKQVEELEQKLHLAD
AKSIETDEKAQELAVVLAELDDLRKRSSQTAELETKIEGLESQLKLANVSSQDQGNVGSP
GELNEVVEAKSRDIGLNVSTPSKRKSKRRSEATSAQTSSTSVIHSPTTEASSPLNFKFIF
GIALVSVIIGIILGKRY
Download sequence
Identical sequences A0A2G5D2P7
Aquca_030_00359.2|PACid:22035700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]