SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5D369 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5D369
Domain Number 1 Region: 163-230,262-395,426-521
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-31
Family WD40-repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 441-694,799-881,1105-1126
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000183
Family WD40-repeat 0.015
Further Details:      
 
Domain Number 3 Region: 721-879,905-936,1105-1120,1245-1368
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000794
Family WD40-repeat 0.029
Further Details:      
 
Domain Number 4 Region: 28-237
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000146
Family WD40-repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5D369
Sequence length 1425
Comment (tr|A0A2G5D369|A0A2G5D369_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA37960.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02900069v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MMAEKEESQNQSQSSAYSWSLESGGYLGEISALCFVHVPLHLSSFPLLLVGSGSEILLYD
VELGVLLNSFHVFEGIRVHGISSGTLDVTHNGMFSTLTSAVVVFGEKRVKLYSLIFQLPL
GSKNKSKVCAELLLNRILPRFSHWVMDVLFLKEDHRPSKFEVNNYLAVGLGDNSVCLWDI
SKSTMAIKVRCPERTLLYSMRLWGTSIDSLKVASGTIYNEVIVWKLDSERHNSSLTMENS
NNYHSLLNTNSQLHDSKYEATYLNRLVGHEGSIFRLAWFPDGSKLMSVSDDRSARIWKIE
AVKNDSNNSEIVNGSDSASLILFGHTARVWDCYISDSLIVTAGEDCTCRVWGMDGKQLLL
KKEHTGRGIWRCTYDPSSSLLITAGFDSSVKVHRLHASLSGDTIEQDKVVMEGFKERMEF
FTLIVPNLSEQVEPLTSKSEYVRCLHFSQEDTLYVATNNGYLHHVKLSGVADVKWAELVH
ISEDAPIVCMDLLSRKASNPSKSLEDWVAVGDGKGNVTIVRVVGSCTPTVEFALTWLAET
ERQLLGTYWCKSLGPSYIFTADPKGTLKLWKIHGHIQSGFEQSSGSFEALLTVLFTSCFG
TRIMCLDALLDEQVLVCGDQRGNLSTFSLSKGLLDTLVVSETKSSPISSFKGAHGISSVT
SISVSKTNFNQVGIESTGGDGCICSFKYNGDWRSLEFTGMKQMKELSLVQSVSSDANSDD
DLACGSYAVGFASADFIVWNLQNETKVVQVSCGGWRRPHSYYLGDVPESQNCFAFVKDHA
IHIHRLWVPAGDKKLISHVLHMQHHGREIHSLCFVSDVIQSSSDENRHSVDRCSCIATGC
EDGTVRLTRYAPDGQNWFASKLLGEHVGGSAVRSICFVSKMYKTAVDKIYKFDSKYECNS
ALDETEIPSLLISVGAKRVLTSWLLRKRKLSNSRKLGCGDIRGSENNFNQSQRASTSMSF
QWLSTDMPSKFSSTRKTMENREKPIVQGKNATNVMDGPASETHVAETNKLESKSLPVDKN
GDDWRYLAVTAFLVRGADSRSIVCFIVVSCSDATLALRALILPYRLWFDVALLGPHRSPV
LSLQNVILPIASCSQDSLQIGGVYTLISGSTDGSITFWDLTKCVEGFMQRMSQIQPESFI
KCQIRPRTGRGSQGGRWWRTLDSQYSKTNPEGLVGTIDGENLSHGHKNNPTTLGASSNMT
TTIVNSKVTCSQSMDRDSLPCSEELTDDLLVEQCEIRPFHVLNNVHQSGVNCLHVSTITS
YKNSESVSTYCVISGGDDQALHCLTFELSLQEADDGFKNGNHSGNANNVTDLHNAIDLSA
DSKNQRCRIRFLFHDRIASAHSSALKGVWTDGTWAFTIGLDQRVRCWYLEEQGKLSEHAH
LIVSVTEPETLDARSCGRNQYQIAVAGRGMQIVKFSASGDKDGRG
Download sequence
Identical sequences A0A2G5D369
Aquca_029_00069.1|PACid:22026268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]