SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5D3G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5D3G2
Domain Number 1 Region: 491-737
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.57e-49
Family Extended AAA-ATPase domain 0.00000673
Further Details:      
 
Domain Number 2 Region: 762-956
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.16e-32
Family FtsH protease domain-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5D3G2
Sequence length 970
Comment (tr|A0A2G5D3G2|A0A2G5D3G2_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA37737.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_03000340v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDIRIHYKANPFLFSSKFSNFSNTSLLCFCKPLPLHLKNKTRKKTHQKFVFRASSDKNDN
WFDGFSWSEVSHSIKQGLGKSLSNFGELLKKETGFDLDEVNIKVGRFVDRVKDTTKKGEV
AVYRFRFELVPAFIEWNAWDQWKDLKSWKPKRIAVLILYTIFVITSCQRIYIACKAPCLN
KQSKRELTEAFMEALIPDPTPSNIKKFKKSIWRKTMPKGLKMKKFIEGPGGELIQDPSYV
GEDAWDDDHEPYQQDLEQIIDSDDKLNSKKSDKLKKDLGISGEDQRSNGRWRERFLAWKE
ILRNEKLAEQVDSLNAKYVVDFDMQEVEKSLRKDVVEKVSDKQGSRALWISKRWWRYRPK
LPYTYFLHKLDYSEVAAVVFSEDLKKLYITMKEGFPLEYVVDIPLDPYLFEIISSSGVEV
DLLQKRQIHYFLRLVIALVPGLMILWFIRDSVMLLHITSKRYLYKKYNQLFDMAYAENFI
LRIGDAGGTKSMFKEVVLGGDVWDLLDELMIYMRNPMQYYEKEVPFVRGVLLSGPPGTGK
TLFARTLAKKSGMPFVFASGAEFTDGEKSGAAKINEIFSIARRNAPSFIFVDEIDAIAGR
HARKDPRRRSTFQALMAQLDGDKEKVGVDRFSLGQAFIFICATNRPDELDIEFVRPGRID
RRLYIGLPDAKQRIQIFGVHSTGKQLAEDVDFEKLVFRTVGYSGADIRNLVNEAGIMSVR
KGHSKISQKDIVDVLDKQLLEGMGVLLTEEEQQKCEESVSLEKKKLLAVHEAGHILLAHL
FPRFDWHAFSQLLPGGKETAISVFYPREGMVDQGYTTFGYMKMQMVVAHGGRCAERVVFG
DEITDGGSDDLKKITKIAREMVISPRNSRLGLSTLVKRLGFKNRPDNPDGKLIKYKWDEP
RVIPADMTFEVSELFTRELTRYIDETEELAMNSLKQNRHILDIIANELLEKSRITGLVYK
TSFKFSSISK
Download sequence
Identical sequences A0A2G5D3G2
Aquca_030_00340.2|PACid:22035861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]