SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5D824 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5D824
Domain Number 1 Region: 7-240
Classification Level Classification E-value
Superfamily 14-3-3 protein 5.1e-105
Family 14-3-3 protein 0.00000000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5D824
Sequence length 256
Comment (tr|A0A2G5D824|A0A2G5D824_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA39666.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02600248v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSPTESSREENVYLAKLAEQAERYEEMVEFMENVAKTVDVEELTVEERNLLSVAYKNVIG
ARRASWRIISSIEQKEENRGNEEHVVVIKEYRGKIETELSKICDGILNLLDSHLVPSATA
AESKVFYLKMKGDYHRYLAEFKTGADRKEAAESTLLAYKSAQDIAVAELPPTHPIRLGLA
LNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSD
ITDDAGDEIKEAPKPE
Download sequence
Identical sequences A0A2G5D824
Aquca_026_00248.1|PACid:22055757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]