SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DAV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DAV3
Domain Number 1 Region: 590-724
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 6.93e-28
Family Staphylococcal nuclease 0.0016
Further Details:      
 
Domain Number 2 Region: 190-239,282-377
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.96e-25
Family Staphylococcal nuclease 0.0037
Further Details:      
 
Domain Number 3 Region: 7-158
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.88e-25
Family Staphylococcal nuclease 0.012
Further Details:      
 
Domain Number 4 Region: 384-465,516-570
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.62e-22
Family Staphylococcal nuclease 0.017
Further Details:      
 
Domain Number 5 Region: 782-866
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.56e-18
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DAV3
Sequence length 940
Comment (tr|A0A2G5DAV3|A0A2G5DAV3_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA40626.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02500377v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MASAGAASGWLRGRVKAVPSGDCLVIMAVTKAEIPPEKTITLSSLVAPRLARRGGVDEPF
AWNSREYLRKLCIGKRWYCFVILMQEVTFRVDYTVPSIGREFGSVFLGDKNVALLVVSEG
WAKVREQGQQKGEVSPFLAELQSLEEQAKQQGSGRWSKVPGASEKAIRNLPPSAIGDPSN
LDAMGLLAANKGRPMEAIVEQVRDGSTVRVYLLPEFQFVQVFVAGIQAPSMGRRGAVETV
VEPEVMSDELNGEASAVPRAPLTSAQRLAASTASSTEVSPDPFGREAKHFTEIRVLHRDV
RIVLEGVDKFSNLVGSVYYPESDSAKDLALELVQNGMAKYLDWSANMMEEDARRKLKTAD
LQAKKDRLRIWTNYIPPATNSKAIHDQNFTGKVVEVVSGDCIIVADDAVPYGSPLAERRV
NLSSIRSPKMGNPRRDEKPAPYAREAREFLRTRLIGRQVNVSMEYSRKVSMVDGPVPVAG
SADSRVMDFGSVFLVSPSKVEADDSTPSPSPSSSQTTGVNVAELVIGRGFGTVIRHRDFE
ERSNFYDALLAAESRAIAGKKGIHSAKDPPVMHITDLLTASSKKAKDFLPFLQRSRRLPA
VVEYVLSGHRFKLLIPKETCTIAFSFSGVRCPGRDEPYSDEAISLMRRKILQRDVEVEVE
TVDRTGTFLGSLWESKTNVAVSLLEAGLAKLQTAFGADRIADAHLLARAEQSAKQKKLKI
WENYIEGQEAANGLVAETRQKEVLKVVVTEVLGGGKFYVQTVGDQKVASIQQQLASLSLQ
DAPVIGIFNPKKGDIVLAQFSADNSWNRAMIVNAPRGVVESPKDIFEVFYIDYGNQEVVT
YSQLRPLDPSVSSAPGLAQLCTLAYVKIPSLEEDFGQEAAEFLSDRTLNSSRELRAMIED
RDASAGKVKGQGTGTVLIITLVDVEAGSSINAAMLEVLLG
Download sequence
Identical sequences A0A2G5DAV3
Aquca_025_00377.6|PACid:22063106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]