SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DB69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DB69
Domain Number 1 Region: 348-472,522-584
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.23e-27
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.04
Further Details:      
 
Domain Number 2 Region: 4-32,80-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.59e-17
Family Dual specificity phosphatase-like 0.075
Further Details:      
 
Domain Number 3 Region: 783-901,937-1008
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.000000000000343
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.056
Further Details:      
 
Weak hits

Sequence:  A0A2G5DB69
Domain Number - Region: 634-706
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0342
Family DNA-binding N-terminal domain of transcription activators 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DB69
Sequence length 1176
Comment (tr|A0A2G5DB69|A0A2G5DB69_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA40734.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02400064v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MQTHILWHNLREEPVVYINGRPFVLRDVERPFSNLEYTGINRERVEQMESRLKEDILQEA
ARYGNKILVTDELPDGQMVDQWEPVTHDSVKTPVEVYEELQVEGYLVDYERVPITDEKSP
KEQDFDILVHRISQADINTEIIFNCQMGRGRTTTGMVIATLVYFNRIGASGIPRTNSIGK
VFDAGSDVTDSLPNSEDAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREA
IATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHTDRSALRFGSSGQSSFTE
WMRARPELYSILRRLLRRDPMGALGYAKLKPSLMKIAESADGRPYEMGVVAALRNGEVLG
SQTVLKSDHCPGCQNLTLPERVEGAPNFREVPGFPVYGVANPTVEGIRAVIRRIGSSKDG
CPVLWHNMREEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAE
HYGGAIMVIHETDDGQIFDAWEHVSSEAIQTPLEVYRCLEVEGFPIKYARVPITDGKAPK
SSDFDTLVMNIASATKDTALVFNCQMGRGRTTTGTVIACLLKLRIGYGRPIRLQLEDMAE
EEVDSDSCSGEETGTSNSPSSASRINEGSGKEPKRLYGIDDILLLRKITRLFDNGAECRE
VLDAIIDKCSALQNIRKAVLQYIKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFSAYL
GSEAFDGFCGQGESRVTFKTWLHQRPEVQTMKWSIRLRPGRFFTVPEEMRTAHESHHGDA
VMEAIVNSRNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKVDGYPVYSMATPTIAG
AKEMLSYLSAQPSKGGDLSRKVILTDLREEAVVYINGTPFVLRELNQPVDTFKHVGITGP
VVEHMEARLKEDILAEVTISGGRMLLHREEYNPALNQISVIGYWENISVDDVKTPAEVYA
HLMDQGYSIRYRRIPLTREREARPADVDAVQNCKDDSAGCYLFVSHTGFGGVSYAMAITC
LRLNAEGCFSSNGVDLLDGADCPTSSPKDDVSSQASEEEACKQGEYRDILSLTRVLIYGP
KSKAKVDFIIERCAGAGHLRDDILYYRKELEKCPIVDDENKTYLMDMSIKALRRYFFLIT
FQAYLYCTSANQMSFTSWMEARPELGHLCYNMRIDK
Download sequence
Identical sequences A0A2G5DB69
Aquca_024_00064.3|PACid:22051415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]