SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DBI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DBI8
Domain Number 1 Region: 256-540
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.77e-75
Family Tandem AAA-ATPase domain 0.000053
Further Details:      
 
Domain Number 2 Region: 13-52
Classification Level Classification E-value
Superfamily WW domain 0.0000000636
Family WW domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DBI8
Sequence length 835
Comment (tr|A0A2G5DBI8|A0A2G5DBI8_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA40597.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02500359v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MAETASASPVGPRYAPEDPTLPKPWKGLVDGTTGYLYFWNPETNITQYERPKASSGRGPS
PAPTKSTSASISSSVHIHHSTQGHLRSSKNDEDIRHNGDNGRPKLAAIPLGKNHQGSRGG
SGRFDDVPNGSGSGANGARGHSSHVFKTSSKPHGSDAATGLSSESYCRQHEITVNGDDVP
SPFTSFESTGFPAEILREVHNAGFSAPTPIQAQTWPVALQSRDIVAIAKTGSGKTLGYLI
PGFIHLKRCRNNPQLGPTVLVLSPTRELATQIQVEAVKFSKSSRIACTCLYGGAPKGPQL
RDLERGVDIVVATPGRLNDILEMRKISLRQVSYLVLDEADRMLDMGFEPQIRKIVQEIPP
RRQTLMYTATWPKEVRKIAADLLVNPVQVNIGSIDELVANKSITQYIEVVTPMEKNRRLE
QILRSQEPGSKVIVFCSTKKMCDQLTRTVTRQFGAAAIHGDKSQGERDYVLNQFRTGKSP
ILVATDVAARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGIAYTFFCEQDAKYA
SDLIKVLEGANQRVPPQIRDMALRGGMGRTRNRWGSGPGGRDGGRGGRIDSSFGGRSGRG
LPPSSARSESGGYGGRGHDIDPRNKYGRGHHDGHNGDLHDRFQKGYPANDNDRRIGDRDR
GRGRSRSPVKGDGWGHPRSRSRSRSRSWNRSRSRSRSHDKYDGPAKVARRHSPVPRRINS
PNVHRSMDSGRSPPPHHRGSLYRKEKSPLRGRSKSPFDGRKHMRPYDPPSRHLGRSPQRA
GNDVKFANGHPLSFNEEEEEEGLIPAEEEEGMIPADDDGRKNSPWKKAENLDIVN
Download sequence
Identical sequences A0A2G5DBI8
Aquca_025_00359.1|PACid:22063297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]