SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DDT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DDT6
Domain Number 1 Region: 427-656,810-888
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000348
Family WD40-repeat 0.049
Further Details:      
 
Weak hits

Sequence:  A0A2G5DDT6
Domain Number - Region: 592-815
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000439
Family WD40-repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DDT6
Sequence length 1089
Comment (tr|A0A2G5DDT6|A0A2G5DDT6_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA41690.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02200250v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSSWNYVVTAHKPTSVSHSCVGNFTGPQELNLIIAKCTRIEIHLLTPQGLQPMLDVPIYG
RIATLELFRPYGEAQDLLFIATDKYRICVLQWDAETSEIITKSNGDVADRIGRPTDNGQL
GMIDPDCRLIGLHLYDGLFKVIPFDNKGQLKEAFNIRLEELQVLDIKFLYGCSKPTIVVL
YQDNKDARHVKTYEVALKEKDFVEGPWSQNNLDNGAGLVIPVPRPLGGVIIIGEETIVYC
SATAFKAIPIRPSITRAYGRVDADGSRYLLSDHTGLLHLLVITHERERVTGLKIELLGET
SIASTISYLDNAFVFVGSNYGDSQLIKLNLQPDAKGSYVEVLERYVNLGPIVDFCVVDLE
RQGQGQVVTCSGAYKDGSLRIVRNGIGINEQASVELQGIKGMWSLRSSTDDPFDTFLVVS
FISETRILAMNPDDELEETEIEGFDSQVQTLCCHDAIHNQLLQVTASSVRLVSSTSRELR
NEWKAPSGFSVNVATANATQVLLATGGGHLVFLEVGDGILTEVKHAQLEYEVSCLDINPI
GENSNASQLAAVGMWTDMSVRIFSLPGLDLITKEHLGGEIIPRSVLLCAFEGVSYLLCAL
GDGHLFNFLLNLSSGELSDRKKVSLGTQPITLRTFSSKNTTHVFAASDRPTVIYSSNKKL
LYSNVNLKEVSHMCPFNSAAFPDSLAIAKEGELTIGTIDDIQKLHIRTIPLGEHARRICH
QEQSRTFAICSLKYCQSNAEESEMHFVRLLDDQTFDFISTYPLDTYEYGCCILSCSFADD
SNTYYCVGTAYVLPEESEPTKGRILVFIVEDGKLQLIAEKETKGSVYSLNAFNGKLLAAI
NQKIQLYKWMLRDDGSRELQSECGHHGHILAIYVQTRGDFIVVGDLMKSISLLIYKHEEG
AIEERARDYNANWMSAVEILDDDVYLGAENSFNLFTVRKNSEGATDEERGRLEVVGEYHL
GEFVNRFRHGSLVMRLPDSDVGQIPTVIFGTVNGVIGVIASLPHAQYLFLEKLQSLLVEV
IKGVGGLGHDQWRAFNNEKKNSEAKNFLDGDLIESFLDLSRSRMDEISKAMLISTEELCK
RVEELTRLH
Download sequence
Identical sequences A0A2G5DDT6
Aquca_022_00250.1|PACid:22055057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]