SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DEM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G5DEM7
Domain Number - Region: 111-177
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0366
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DEM7
Sequence length 290
Comment (tr|A0A2G5DEM7|A0A2G5DEM7_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA41687.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02200248v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MNHDRSFSSPELIPHGSHAEHSNDSTLEGVSTNIKLLLKIIQDHNNASPRDDDGRRMQRV
AGMLTILDDVKHRIQKSQSFGKKKEIEFRRCYTDLRPNRIPKDKKPPEPLDEKQKLLKEL
NDSLAARKSLERMFSSLGKEKAIMSAELAKKAQELNSLEEQLNDLREQNAMLMEKVQTCA
SKHKKVSGDSQGNATLQERNKALSEQLLKSLDGYRSAKRKMKEAQEENATFRAKMGEMAE
EIVAGLNRLHAFQQQIAEKNEDVDMEEELSALEHMLQGIETKISSDEPKE
Download sequence
Identical sequences A0A2G5DEM7
Aquca_022_00248.1|PACid:22054809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]