SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DHB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DHB2
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily Mannose-binding lectins 0.00000000000000157
Family Mannose-binding lectins 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DHB2
Sequence length 76
Comment (tr|A0A2G5DHB2|A0A2G5DHB2_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA42885.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02000380v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MKVTGFYGPVEENGGLDALRSLSFYTNKGKYGPFGDEIGTYFASFPRNVVGFHGRAGVYL
DDLSVHTEYIQPSAVV
Download sequence
Identical sequences A0A2G5DHB2
Aquca_020_00380.1|PACid:22025264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]