SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DNG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DNG7
Domain Number 1 Region: 118-380
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.85e-65
Family BC ATP-binding domain-like 0.00000204
Further Details:      
 
Domain Number 2 Region: 25-148
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.98e-49
Family BC N-terminal domain-like 0.0000208
Further Details:      
 
Domain Number 3 Region: 367-482
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.52e-35
Family BC C-terminal domain-like 0.00027
Further Details:      
 
Domain Number 4 Region: 661-733
Classification Level Classification E-value
Superfamily Single hybrid motif 5.63e-17
Family Biotinyl/lipoyl-carrier proteins and domains 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DNG7
Sequence length 736
Comment (tr|A0A2G5DNG7|A0A2G5DNG7_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA45016.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01700521v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MSLMASIIRRKIRTNHFLLTKNPFSSCSSEMKMNEPIEKILIANRGEIACRIMKTSKRLG
IQTVAVYSDADKDSLHVKSADEAIRIGPPPARLSYLNSSHIIQAAHRTGAQAIHPGYGFL
SESAEFAQLCEAEGLIFIGPPASAIRKMGDKSASKRIMGAAGVPLVPGYHGDEQDIDFMK
LEADKIGYPILIKPTHGGGGKGMRIVQSPDEFVESFLGAQREAAASFGVKTILLEKYITQ
PRHIEVQIFGDKHGNVLHLYERDCSVQRRHQKIIEEAPAPNVKAEFRSHLGEAAVSAAKA
VSYHNAGTVEFIVDTISGQFYFMEMNTRLQVEHPVTEMIVGQDLVEWQIRVANGEPLPLS
QAQVPLKGHAFEARIYAENVPKGFLPAAGVLRHYDPVTVSSTVRVETGVEQGDTVSMHYD
PMIAKLVVWGEDRNAALVKMKDCLSKFQVAGLPTNINFLQRLASHWAFQKGQVETHFIEH
FKADLLNDPSDTTMTTEAYAAGLHALALVGACICEKEQVKSVESLHGSNNLNSIWYAGPP
FRVHHLARRTMEFQWDFEYDSVSSNILRLDITYQPDRTYLVQTGDSNSPGMIIRVFHFGH
HKFRVEADGLSTDVSLAVYSKESSKHFHIWNGKHHHHFWQNIGLELPTDDGSQHKPNLET
TSHPRGTVVAPMAGLVVKILVKDGVKVVEGQPVLVLEAMKMEHIVKAPSTGYVNGLQVTS
GQQVFDNSVLFSVKDE
Download sequence
Identical sequences A0A2G5DNG7
Aquca_017_00521.1|PACid:22031361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]