SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DRP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DRP4
Domain Number 1 Region: 7-170
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000108
Family WD40-repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DRP4
Sequence length 172
Comment (tr|A0A2G5DRP4|A0A2G5DRP4_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA46182.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01500001v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MPTEGPKYIVVAGEQSSEVEIWDLNSAERIARVPQICYGDTSNHCTKARGMCMAVQAFLP
SQSQGFLNLLAGYEDGSIAWWDIRSLEVPLTTAKFHSEPVLSLTVDGPCTGGISGAADQK
LVFFTLDHQTGSCLIKKEISLERPGIAGSSIRMDGKIAATAGWDHRLCISPI
Download sequence
Identical sequences A0A2G5DRP4
Aquca_015_00001.1|PACid:22041807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]