SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5DZR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DZR8
Domain Number 1 Region: 113-226
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000451
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DZR8
Sequence length 240
Comment (tr|A0A2G5DZR8|A0A2G5DZR8_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA49000.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01300095v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDDDIGKIKVFPDHFAASTPSGDSLEKQVSSVSQTRTDYSLRYHNRISTQRKLMGAASML
NMFSVPGLPWRSGKDDQEKAELTAESLRSEIAALEEREAHFKARLEHVDEILRSARLAGY
LHIRTRWTALPGEPPIDDTDVDDWLPRFVVLQGSCIFFYLLSTDLSPQDSTLLSDVVEVI
PLSSSIHEDGQRFIFHVLTRQGLRFECWSSSKSQVDSWLKALMEDCKLESDTTPRKTSES
Download sequence
Identical sequences A0A2G5DZR8
Aquca_013_00095.1|PACid:22059218 Aquca_013_00095.2|PACid:22059217 Aquca_013_00095.3|PACid:22059219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]