SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5E1T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5E1T6
Domain Number 1 Region: 111-242
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-16
Family Ran-binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5E1T6
Sequence length 244
Comment (tr|A0A2G5E1T6|A0A2G5E1T6_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA49681.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01300444v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDKFRDVVDWLKTNAAKAESLPVFGASSTENKSIFETKNNETKFQLPEKSGFGQVGFTSG
FTSAWSSSVPQKSQTSGFFGIQNPAPTTHDASDEPDGEDELEQPSSPSVKKSEEKGVVMV
HEVKCKLYVKSTDPTDKDVWKDRGMGQLSIKCKEGVSKATKESKPTIVVRNDVGKILLNA
LLYPGIKTNLVKNAIAAIFHTSGDANGNDVATNGVVARTYLIKTKTEEDRNKLASAIQEY
APAA
Download sequence
Identical sequences A0A2G5E1T6
Aquca_013_00444.4|PACid:22059982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]