SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2G5E9G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5E9G3
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-22
Family B3 DNA binding domain 0.00083
Further Details:      
 
Domain Number 2 Region: 380-472
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-18
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 3 Region: 126-217
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-16
Family B3 DNA binding domain 0.0068
Further Details:      
 
Domain Number 4 Region: 222-302
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-16
Family B3 DNA binding domain 0.0012
Further Details:      
 
Domain Number 5 Region: 541-622
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-16
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5E9G3
Sequence length 623
Comment (tr|A0A2G5E9G3|A0A2G5E9G3_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA52393.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01000338v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MDSMLHHTSNIPNFFKVMVGDFQKKLSLPKALTLCFKPKVPKMFTLISPTGSSWMVSVKR
VDKDFFLANGWKTFAEDYALELGEFVVFRYKGDNAFSVKVFGKNACEKEVPSTNKNIEEV
ANHVTSKYPMFTTTVPKGDLTWYTTLIIPKLFAKKYLKNNHLGLTRDVTLRVTTGGTWNL
RYSVGVHRRLIGGWKTFVVGNNLKARDILVFELVDRNPIQMNCLPTDYIKNFNGDVPKQF
ILTSSTRRFWEVFVKKIDNNLFLSEQWPIFAKDNALEFGDLLVFIYNGNLEFRVKIFGSN
ACEKDVELALKNNVESDFYLREEKEGNDRGIPDKLHSPDILKCYKRRRTAEAAVTDKVTS
LPNSMSIKTERSEVMEVGLSFNATFQPSRKYKIGIPNEIVKEKGLSVKDKMLLLDPCGRS
WPVTIYCWSKGRTFLTAGWPAFCKANRLNTNDTCHFQFIDGVDNAIRVEIFRTRTPPPIA
KQASAGVKMSTAIPREVIEAPTRKRPGEFVDDRVIHNGKQESLLMTDCSNNDEQTMSTAP
NVAVLPSAFAKKHMKHAPRGVILRDSNGGTWHAQYKIGSHHKLNMGWKTFVFDNHLKECD
VCIFELVDENLTHYELKVTIIRH
Download sequence
Identical sequences A0A2G5E9G3
Aquca_010_00338.1|PACid:22046925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]